prot_M-pyrifera_M_contig8730.20290.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8730.20290.1 vs. uniprot
Match: D7FIW5_ECTSI (RING-type domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FIW5_ECTSI) HSP 1 Score: 80.5 bits (197), Expect = 1.700e-16 Identity = 37/44 (84.09%), Postives = 38/44 (86.36%), Query Frame = 0 Query: 1 ELDRARKCVACLMRERDTLLFPCKHLVLCGACYKRVVHQAERDA 44 ELDRARKCVACL R+RDTLLFPCKHLVLC CY RVV QAE DA Sbjct: 608 ELDRARKCVACLSRDRDTLLFPCKHLVLCSQCYTRVVRQAEDDA 651
BLAST of mRNA_M-pyrifera_M_contig8730.20290.1 vs. uniprot
Match: A0A383VPS7_TETOB (RING-type E3 ubiquitin transferase n=1 Tax=Tetradesmus obliquus TaxID=3088 RepID=A0A383VPS7_TETOB) HSP 1 Score: 47.4 bits (111), Expect = 8.050e-5 Identity = 22/42 (52.38%), Postives = 26/42 (61.90%), Query Frame = 0 Query: 1 ELDRARKCVACLMRERDTLLFPCKHLVLCGACYKRVVHQAER 42 +L +A CV CL RDTLL PCKHLVLC C + A+R Sbjct: 713 QLHQATHCVVCLDAPRDTLLLPCKHLVLCQGCSCHLQQLAQR 754 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8730.20290.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig8730.20290.1 ID=prot_M-pyrifera_M_contig8730.20290.1|Name=mRNA_M-pyrifera_M_contig8730.20290.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=47bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|