prot_M-pyrifera_M_contig790.18557.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig790.18557.1 vs. uniprot
Match: Q8QNP7_ESV1K (EsV-1-12 n=1 Tax=Ectocarpus siliculosus virus 1 (isolate New Zealand/Kaikoura/1988) TaxID=654926 RepID=Q8QNP7_ESV1K) HSP 1 Score: 77.8 bits (190), Expect = 3.000e-14 Identity = 34/45 (75.56%), Postives = 38/45 (84.44%), Query Frame = 0 Query: 1 MPLLIPVVNDSKGETVTPTCYKDDGPFTCLGCAKPLVLRQGEKNR 45 M LLIPV + GETVTPTC K+DGPF CLGCAKPLVLRQG+KN+ Sbjct: 1 MSLLIPVAKNKTGETVTPTCNKEDGPFACLGCAKPLVLRQGQKNQ 45 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig790.18557.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig790.18557.1 ID=prot_M-pyrifera_M_contig790.18557.1|Name=mRNA_M-pyrifera_M_contig790.18557.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=163bpback to top |