prot_M-pyrifera_M_contig78399.18426.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig78399.18426.1 vs. uniprot
Match: UPI001260ED78 (type II toxin-antitoxin system ParD family antitoxin n=1 Tax=Tautonia marina TaxID=2653855 RepID=UPI001260ED78) HSP 1 Score: 48.1 bits (113), Expect = 2.320e-5 Identity = 28/76 (36.84%), Postives = 42/76 (55.26%), Query Frame = 0 Query: 10 LEDRLEGGPYASLAELIEEALKALDQSVATE----DWLEEKLREAEASGPAAPMTQQDWDDIEREGFERIRAKSPK 81 + +L+ G YAS +++++AL L Q A + +E L + SGPA PMT DWD++EREG I + K Sbjct: 13 IRSQLQSGKYASEDDVVDQALDLLRQREAEQASERSRVESLLIQGLDSGPATPMTSDDWDEVEREGQRLIAERKAK 88
BLAST of mRNA_M-pyrifera_M_contig78399.18426.1 vs. uniprot
Match: UPI001993B626 (Type II toxin-antitoxin system ParD family antitoxin n=1 Tax=Gloeobacterales cyanobacterium ES-bin-313 TaxID=2812629 RepID=UPI001993B626) HSP 1 Score: 46.6 bits (109), Expect = 9.640e-5 Identity = 29/79 (36.71%), Postives = 43/79 (54.43%), Query Frame = 0 Query: 2 LPQKLLHELEDRLEGGPYASLAELIEEALKALDQSVATEDWLEEKLREAEASGPAAPMTQQDWDDIEREGFERIRAKSP 80 LP+ + +E R++ G +++ +E + AL DQ E+ LE L E SGPA PMT QDW +I E R++ P Sbjct: 8 LPKVMKDYVESRVQEGGFSTPSEYMR-ALVREDQKRKAEEKLEALLLEGIQSGPATPMTPQDWKEIRAEVLRRVQRGEP 85 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig78399.18426.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig78399.18426.1 ID=prot_M-pyrifera_M_contig78399.18426.1|Name=mRNA_M-pyrifera_M_contig78399.18426.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=82bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|