mRNA_M-pyrifera_M_contig77286.18210.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig77286.18210.1 vs. uniprot
Match: UPI001F4A9F93 (hypothetical protein n=1 Tax=Belliella kenyensis TaxID=1472724 RepID=UPI001F4A9F93) HSP 1 Score: 48.9 bits (115), Expect = 3.480e-5 Identity = 26/64 (40.62%), Postives = 36/64 (56.25%), Query Frame = 1 Query: 1 EQLEIPLNNNSGIPFYEDQ--LGVYVEGFDIDNQGDLYFAGGAE-----ETWITRFSNDKMLYK 171 EQ+ IPLN NSG+PF D G +EGFD+D G YF +E + + F +K++YK Sbjct: 75 EQIIIPLNLNSGVPFLNDVNIYGYIIEGFDVDESGLFYFLVNSEVQSGNSSILACFEKNKLVYK 138 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig77286.18210.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig77286.18210.1 >prot_M-pyrifera_M_contig77286.18210.1 ID=prot_M-pyrifera_M_contig77286.18210.1|Name=mRNA_M-pyrifera_M_contig77286.18210.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=57bp EQLEIPLNNNSGIPFYEDQLGVYVEGFDIDNQGDLYFAGGAEETWITRFSback to top mRNA from alignment at M-pyrifera_M_contig77286:267..437- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig77286.18210.1 ID=mRNA_M-pyrifera_M_contig77286.18210.1|Name=mRNA_M-pyrifera_M_contig77286.18210.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=171bp|location=Sequence derived from alignment at M-pyrifera_M_contig77286:267..437- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig77286:267..437- >mRNA_M-pyrifera_M_contig77286.18210.1 ID=mRNA_M-pyrifera_M_contig77286.18210.1|Name=mRNA_M-pyrifera_M_contig77286.18210.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=342bp|location=Sequence derived from alignment at M-pyrifera_M_contig77286:267..437- (Macrocystis pyrifera P11B4 male)back to top |