mRNA_M-pyrifera_M_contig75856.17894.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75856.17894.1 vs. uniprot
Match: A0A5K0VCH0_9MAGN (Uncharacterized protein (Fragment) n=1 Tax=Nymphaea colorata TaxID=210225 RepID=A0A5K0VCH0_9MAGN) HSP 1 Score: 52.0 bits (123), Expect = 4.850e-5 Identity = 37/125 (29.60%), Postives = 56/125 (44.80%), Query Frame = 1 Query: 37 YYGNCLSFIQKELPVEDVQTMPLAELAILVRTLVESYEAQDATDAVNLMKETYFNHGASGLVSLEPPMDYPTSMI-----VSNWAKFRSYDVDFGQGRPLRFVYPLWIAMPGVNIVNTRVGADGD 396 Y+GN + + E VED+ P+ A L+ +EA DA F+ L P D ++ V +W +F YDVDFG GRP RF+ P ++ + G+ I+ +GD Sbjct: 292 YFGNMVLWAWPESRVEDLLAKPIGHAARLI------HEAAARVDADYFKSFIDFSSSKEKTEGLMPSADEGKMVLSPDLEVDSWLRFPFYDVDFGSGRPHRFM-PSYLPVEGLLILVPSFSGNGD 409 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75856.17894.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig75856.17894.1 >prot_M-pyrifera_M_contig75856.17894.1 ID=prot_M-pyrifera_M_contig75856.17894.1|Name=mRNA_M-pyrifera_M_contig75856.17894.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=134bp MLGLGSNYYGNCLSFIQKELPVEDVQTMPLAELAILVRTLVESYEAQDATback to top mRNA from alignment at M-pyrifera_M_contig75856:363..839- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig75856.17894.1 ID=mRNA_M-pyrifera_M_contig75856.17894.1|Name=mRNA_M-pyrifera_M_contig75856.17894.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=477bp|location=Sequence derived from alignment at M-pyrifera_M_contig75856:363..839- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig75856:363..839- >mRNA_M-pyrifera_M_contig75856.17894.1 ID=mRNA_M-pyrifera_M_contig75856.17894.1|Name=mRNA_M-pyrifera_M_contig75856.17894.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=804bp|location=Sequence derived from alignment at M-pyrifera_M_contig75856:363..839- (Macrocystis pyrifera P11B4 male)back to top |