mRNA_M-pyrifera_M_contig73925.17511.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig73925.17511.1 vs. uniprot
Match: A0A1V9Y4P0_9STRA (Uncharacterized protein n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9Y4P0_9STRA) HSP 1 Score: 49.3 bits (116), Expect = 3.560e-6 Identity = 21/35 (60.00%), Postives = 28/35 (80.00%), Query Frame = 1 Query: 1 TGNPANRQNGAFGYLGLLAMLGMSVELAVSLIRSS 105 +GNPA R NG FGYLGL A +G+S+E A++LI S+ Sbjct: 110 SGNPAKRMNGGFGYLGLFASIGLSIEAAITLINSA 144
BLAST of mRNA_M-pyrifera_M_contig73925.17511.1 vs. uniprot
Match: A0A1V9Y7C0_9STRA (Uncharacterized protein n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1V9Y7C0_9STRA) HSP 1 Score: 48.1 bits (113), Expect = 9.900e-6 Identity = 22/35 (62.86%), Postives = 27/35 (77.14%), Query Frame = 1 Query: 1 TGNPANRQNGAFGYLGLLAMLGMSVELAVSLIRSS 105 TG+P R NGAFGYLGL A +G+S+E AV LI S+ Sbjct: 110 TGDPTKRMNGAFGYLGLFAAIGLSIEAAVRLITSA 144
BLAST of mRNA_M-pyrifera_M_contig73925.17511.1 vs. uniprot
Match: A0A067CU62_SAPPC (Uncharacterized protein n=1 Tax=Saprolegnia parasitica (strain CBS 223.65) TaxID=695850 RepID=A0A067CU62_SAPPC) HSP 1 Score: 46.2 bits (108), Expect = 5.410e-5 Identity = 20/35 (57.14%), Postives = 28/35 (80.00%), Query Frame = 1 Query: 1 TGNPANRQNGAFGYLGLLAMLGMSVELAVSLIRSS 105 TG+PA R +G FGYLGL A LG+S+E A++L+ S+ Sbjct: 110 TGDPAKRMHGGFGYLGLFASLGLSIEAAITLLYSA 144 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig73925.17511.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig73925.17511.1 >prot_M-pyrifera_M_contig73925.17511.1 ID=prot_M-pyrifera_M_contig73925.17511.1|Name=mRNA_M-pyrifera_M_contig73925.17511.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=36bp TGNPANRQNGAFGYLGLLAMLGMSVELAVSLIRSS*back to top mRNA from alignment at M-pyrifera_M_contig73925:915..1022+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig73925.17511.1 ID=mRNA_M-pyrifera_M_contig73925.17511.1|Name=mRNA_M-pyrifera_M_contig73925.17511.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=108bp|location=Sequence derived from alignment at M-pyrifera_M_contig73925:915..1022+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig73925:915..1022+ >mRNA_M-pyrifera_M_contig73925.17511.1 ID=mRNA_M-pyrifera_M_contig73925.17511.1|Name=mRNA_M-pyrifera_M_contig73925.17511.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=216bp|location=Sequence derived from alignment at M-pyrifera_M_contig73925:915..1022+ (Macrocystis pyrifera P11B4 male)back to top |