mRNA_M-pyrifera_M_contig73342.17395.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig73342.17395.1 vs. uniprot
Match: A0A518D3F9_9BACT (PilZ domain-containing protein n=1 Tax=Planctomycetes bacterium Pla163 TaxID=2528008 RepID=A0A518D3F9_9BACT) HSP 1 Score: 48.9 bits (115), Expect = 7.360e-5 Identity = 25/67 (37.31%), Postives = 41/67 (61.19%), Query Frame = 1 Query: 121 GHTIDVSTAGARTEMMRPARVGDHYLMRLFTKEDQPVEV---VARCLRCILLTENRFEVALRFLAPL 312 G +D+S G R E+ P+ VGD +++ E++ VE+ ARCLRC + E R+E + +FL+P+ Sbjct: 57 GTLLDISRGGFRAELDAPSPVGD--VLQAVLVENEEVEIEPRFARCLRCAVAAEGRYEASFQFLSPV 121 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig73342.17395.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig73342.17395.1 >prot_M-pyrifera_M_contig73342.17395.1 ID=prot_M-pyrifera_M_contig73342.17395.1|Name=mRNA_M-pyrifera_M_contig73342.17395.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=118bp LERQLAPETEERRGAERHTLRIAVRLNPADASRLDEPATVGHTIDVSTAGback to top mRNA from alignment at M-pyrifera_M_contig73342:746..1099- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig73342.17395.1 ID=mRNA_M-pyrifera_M_contig73342.17395.1|Name=mRNA_M-pyrifera_M_contig73342.17395.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=354bp|location=Sequence derived from alignment at M-pyrifera_M_contig73342:746..1099- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig73342:746..1099- >mRNA_M-pyrifera_M_contig73342.17395.1 ID=mRNA_M-pyrifera_M_contig73342.17395.1|Name=mRNA_M-pyrifera_M_contig73342.17395.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=708bp|location=Sequence derived from alignment at M-pyrifera_M_contig73342:746..1099- (Macrocystis pyrifera P11B4 male)back to top |