mRNA_M-pyrifera_M_contig104073.871.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104073.871.1 vs. uniprot
Match: A0A4P9ZZA8_9FUNG (EXS family-domain-containing protein (Fragment) n=1 Tax=Dimargaris cristalligena TaxID=215637 RepID=A0A4P9ZZA8_9FUNG) HSP 1 Score: 71.6 bits (174), Expect = 1.130e-13 Identity = 28/33 (84.85%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 10 YRRFQWNIIRMENEHVNNCGRFRAVADVPLPYD 108 YRRFQWNI RMENEHVNNCG+FRA D+PLPYD Sbjct: 323 YRRFQWNIFRMENEHVNNCGQFRATKDIPLPYD 355
BLAST of mRNA_M-pyrifera_M_contig104073.871.1 vs. uniprot
Match: A0A2G4SY43_RHIZD (EXS domain-containing protein (Fragment) n=1 Tax=Rhizopus microsporus ATCC 52813 TaxID=1340429 RepID=A0A2G4SY43_RHIZD) HSP 1 Score: 64.3 bits (155), Expect = 1.940e-11 Identity = 23/35 (65.71%), Postives = 29/35 (82.86%), Query Frame = 1 Query: 1 LTSYRRFQWNIIRMENEHVNNCGRFRAVADVPLPY 105 L YRRFQWN R+ENEH+NNCG FRA+ ++PLP+ Sbjct: 81 LEVYRRFQWNFFRLENEHINNCGNFRAIKEIPLPF 115
BLAST of mRNA_M-pyrifera_M_contig104073.871.1 vs. uniprot
Match: A0A4P9XTL7_9FUNG (EXS family-domain-containing protein (Fragment) n=1 Tax=Thamnocephalis sphaerospora TaxID=78915 RepID=A0A4P9XTL7_9FUNG) HSP 1 Score: 62.4 bits (150), Expect = 1.950e-11 Identity = 23/31 (74.19%), Postives = 27/31 (87.10%), Query Frame = 1 Query: 13 RRFQWNIIRMENEHVNNCGRFRAVADVPLPY 105 RRFQWN RMENEHVNNCG FRA+ ++PLP+ Sbjct: 90 RRFQWNFFRMENEHVNNCGMFRAIREIPLPF 120
BLAST of mRNA_M-pyrifera_M_contig104073.871.1 vs. uniprot
Match: A0A1Y2FNJ8_9FUNG (EXS domain-containing protein n=1 Tax=Neocallimastix californiae TaxID=1754190 RepID=A0A1Y2FNJ8_9FUNG) HSP 1 Score: 64.7 bits (156), Expect = 3.730e-11 Identity = 25/36 (69.44%), Postives = 30/36 (83.33%), Query Frame = 1 Query: 1 LTSYRRFQWNIIRMENEHVNNCGRFRAVADVPLPYD 108 L ++RRFQWN RMENEH NNCG FRAV ++PLPY+ Sbjct: 2 LWNHRRFQWNFFRMENEHTNNCGEFRAVKEMPLPYN 37
BLAST of mRNA_M-pyrifera_M_contig104073.871.1 vs. uniprot
Match: A0A8H7PUH4_MORIS (Uncharacterized protein n=1 Tax=Mortierella isabellina TaxID=91625 RepID=A0A8H7PUH4_MORIS) HSP 1 Score: 64.3 bits (155), Expect = 5.060e-11 Identity = 23/35 (65.71%), Postives = 30/35 (85.71%), Query Frame = 1 Query: 1 LTSYRRFQWNIIRMENEHVNNCGRFRAVADVPLPY 105 L YRRFQWN R+ENEH+NNCG+FRA+ ++PLP+ Sbjct: 696 LECYRRFQWNFFRLENEHLNNCGQFRAIKEIPLPF 730
BLAST of mRNA_M-pyrifera_M_contig104073.871.1 vs. uniprot
Match: A0A367JF66_RHIAZ (Uncharacterized protein n=1 Tax=Rhizopus azygosporus TaxID=86630 RepID=A0A367JF66_RHIAZ) HSP 1 Score: 64.3 bits (155), Expect = 5.060e-11 Identity = 23/35 (65.71%), Postives = 29/35 (82.86%), Query Frame = 1 Query: 1 LTSYRRFQWNIIRMENEHVNNCGRFRAVADVPLPY 105 L YRRFQWN R+ENEH+NNCG FRA+ ++PLP+ Sbjct: 690 LEVYRRFQWNFFRLENEHINNCGNFRAIKEIPLPF 724
BLAST of mRNA_M-pyrifera_M_contig104073.871.1 vs. uniprot
Match: A0A1Y2AH53_9FUNG (EXS-domain-containing protein (Fragment) n=1 Tax=Neocallimastix californiae TaxID=1754190 RepID=A0A1Y2AH53_9FUNG) HSP 1 Score: 63.2 bits (152), Expect = 7.670e-11 Identity = 24/33 (72.73%), Postives = 28/33 (84.85%), Query Frame = 1 Query: 10 YRRFQWNIIRMENEHVNNCGRFRAVADVPLPYD 108 +RRFQWN RMENEH NNCG FRAV ++PLPY+ Sbjct: 215 FRRFQWNFFRMENEHTNNCGDFRAVKEMPLPYN 247
BLAST of mRNA_M-pyrifera_M_contig104073.871.1 vs. uniprot
Match: A0A1Y1WR62_9FUNG (EXS-domain-containing protein (Fragment) n=1 Tax=Anaeromyces robustus TaxID=1754192 RepID=A0A1Y1WR62_9FUNG) HSP 1 Score: 63.5 bits (153), Expect = 9.530e-11 Identity = 24/32 (75.00%), Postives = 27/32 (84.38%), Query Frame = 1 Query: 10 YRRFQWNIIRMENEHVNNCGRFRAVADVPLPY 105 +RRFQWN RMENEH NNCG FRAV ++PLPY Sbjct: 181 FRRFQWNFFRMENEHTNNCGEFRAVKEMPLPY 212
BLAST of mRNA_M-pyrifera_M_contig104073.871.1 vs. uniprot
Match: UPI000644ED61 (hypothetical protein n=1 Tax=Acytostelium subglobosum LB1 TaxID=1410327 RepID=UPI000644ED61) HSP 1 Score: 63.2 bits (152), Expect = 1.290e-10 Identity = 23/32 (71.88%), Postives = 28/32 (87.50%), Query Frame = 1 Query: 13 RRFQWNIIRMENEHVNNCGRFRAVADVPLPYD 108 RR QWN+ R+ENEH+NNCGRFRA D+PLPY+ Sbjct: 853 RRGQWNVYRLENEHINNCGRFRATRDIPLPYE 884
BLAST of mRNA_M-pyrifera_M_contig104073.871.1 vs. uniprot
Match: D3B217_POLPP (SPX domain-containing protein n=1 Tax=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) TaxID=670386 RepID=D3B217_POLPP) HSP 1 Score: 63.2 bits (152), Expect = 1.290e-10 Identity = 23/32 (71.88%), Postives = 28/32 (87.50%), Query Frame = 1 Query: 13 RRFQWNIIRMENEHVNNCGRFRAVADVPLPYD 108 RR QWN+ R+ENEH+NNCGRFRA D+PLPY+ Sbjct: 850 RRGQWNVYRLENEHINNCGRFRATRDIPLPYE 881 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104073.871.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig104073.871.1 >prot_M-pyrifera_M_contig104073.871.1 ID=prot_M-pyrifera_M_contig104073.871.1|Name=mRNA_M-pyrifera_M_contig104073.871.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=36bp LTSYRRFQWNIIRMENEHVNNCGRFRAVADVPLPYDback to top mRNA from alignment at M-pyrifera_M_contig104073:481..588- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig104073.871.1 ID=mRNA_M-pyrifera_M_contig104073.871.1|Name=mRNA_M-pyrifera_M_contig104073.871.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=108bp|location=Sequence derived from alignment at M-pyrifera_M_contig104073:481..588- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig104073:481..588- >mRNA_M-pyrifera_M_contig104073.871.1 ID=mRNA_M-pyrifera_M_contig104073.871.1|Name=mRNA_M-pyrifera_M_contig104073.871.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=216bp|location=Sequence derived from alignment at M-pyrifera_M_contig104073:481..588- (Macrocystis pyrifera P11B4 male)back to top |