prot_M-pyrifera_M_contig98300.22643.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig98300.22643.1 vs. uniprot
Match: UPI000719E09A (biogenesis of lysosome-related organelles complex 1 subunit 4-like n=1 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719E09A) HSP 1 Score: 50.4 bits (119), Expect = 7.210e-5 Identity = 26/78 (33.33%), Postives = 54/78 (69.23%), Query Frame = 0 Query: 42 VEARLTKMDELTSLVAGVRAESARTFGEALPELVEQARQVERIFGLVEELEGFMRQVAHSAREMDLAIARAEAGQASL 119 V+ LT+++E +SL+ VRA+SA E +P ++ + R++E++F V++LE F+ V + ++++ A+ +AE+ ++SL Sbjct: 58 VDEMLTRLEEFSSLLDIVRADSALCLEETMPRILAKRREMEQVFASVDQLEAFVATVRLNLQQLEEAVEKAESERSSL 135 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig98300.22643.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig98300.22643.1 ID=prot_M-pyrifera_M_contig98300.22643.1|Name=mRNA_M-pyrifera_M_contig98300.22643.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=121bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|