Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR013211 | LVIVD | PFAM | PF08309 | LVIVD | coord: 33..73
e-value: 1.6E-7
score: 30.5 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_N_REGION | Signal peptide N-region | coord: 1..1 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_H_REGION | Signal peptide H-region | coord: 2..13 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE | Signal Peptide | coord: 1..21 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_C_REGION | Signal peptide C-region | coord: 14..21 |
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 22..105 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig97728.22509.1 ID=prot_M-pyrifera_M_contig97728.22509.1|Name=mRNA_M-pyrifera_M_contig97728.22509.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=105bp
MLISAAASQILAGSDPCPVSTSFVGEYRTPATANQVQIEDAIAYVVDWFP
NTSLRIIDISDPASPSLLGSFSTSTSPIGFAVENGIVYLPSGSLRIIDAT
DPAIP back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
| Term | Definition |
|---|
| IPR013211 | LVIVD |
|