prot_M-pyrifera_M_contig91703.21244.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig91703.21244.1 vs. uniprot
Match: UPI001C68C35D (hypothetical protein n=1 Tax=Cylindrospermopsis raciborskii TaxID=77022 RepID=UPI001C68C35D) HSP 1 Score: 54.3 bits (129), Expect = 4.090e-6 Identity = 31/43 (72.09%), Postives = 33/43 (76.74%), Query Frame = 0 Query: 4 VSSDLASGVVSISSTFYAFAALKEDGSVITWGSSSYGGDSSLV 46 +SS L SGV I ST YAFAALK DGSV+TWGSS YG DSS V Sbjct: 1 MSSRLTSGVTQIFSTGYAFAALKSDGSVVTWGSSFYGEDSSSV 43
BLAST of mRNA_M-pyrifera_M_contig91703.21244.1 vs. uniprot
Match: A0A838WR53_9CYAN (Uncharacterized protein (Fragment) n=5 Tax=Cylindrospermopsis raciborskii TaxID=77022 RepID=A0A838WR53_9CYAN) HSP 1 Score: 53.5 bits (127), Expect = 5.750e-6 Identity = 30/43 (69.77%), Postives = 32/43 (74.42%), Query Frame = 0 Query: 4 VSSDLASGVVSISSTFYAFAALKEDGSVITWGSSSYGGDSSLV 46 +SS L SGV I S YAFAALK DGSV+TWG SS GGDSS V Sbjct: 1 MSSRLTSGVTQIFSNVYAFAALKSDGSVVTWGESSNGGDSSSV 43
BLAST of mRNA_M-pyrifera_M_contig91703.21244.1 vs. uniprot
Match: UPI0015E0FBA8 (hypothetical protein n=1 Tax=Cylindrospermopsis raciborskii TaxID=77022 RepID=UPI0015E0FBA8) HSP 1 Score: 57.8 bits (138), Expect = 6.730e-6 Identity = 31/43 (72.09%), Postives = 34/43 (79.07%), Query Frame = 0 Query: 4 VSSDLASGVVSISSTFYAFAALKEDGSVITWGSSSYGGDSSLV 46 +SS L SGV I STF AFAALK DGSV+TWG S+YGGDSS V Sbjct: 1 MSSSLTSGVTQIFSTFSAFAALKSDGSVVTWGDSNYGGDSSSV 43
BLAST of mRNA_M-pyrifera_M_contig91703.21244.1 vs. uniprot
Match: A0A562IZM9_9GAMM (Alpha-tubulin suppressor-like RCC1 family protein n=1 Tax=Azomonas agilis TaxID=116849 RepID=A0A562IZM9_9GAMM) HSP 1 Score: 54.7 bits (130), Expect = 7.190e-5 Identity = 29/41 (70.73%), Postives = 34/41 (82.93%), Query Frame = 0 Query: 4 VSSDLASGVVSISSTFYAFAALKEDGSVITWGSSSYGGDSS 44 +SS L+SGVV I ST AFAALK DGSV+TWG ++YGGDSS Sbjct: 1180 ISSKLSSGVVQIFSTSSAFAALKTDGSVVTWGDATYGGDSS 1220 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig91703.21244.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig91703.21244.1 ID=prot_M-pyrifera_M_contig91703.21244.1|Name=mRNA_M-pyrifera_M_contig91703.21244.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=249bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|