prot_M-pyrifera_M_contig9055.20997.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig9055.20997.1 vs. uniprot
Match: A0A091JB72_EGRGA (Ubiquitin carboxyl-terminal hydrolase 42 (Fragment) n=1 Tax=Egretta garzetta TaxID=188379 RepID=A0A091JB72_EGRGA) HSP 1 Score: 52.8 bits (125), Expect = 1.110e-5 Identity = 35/101 (34.65%), Postives = 54/101 (53.47%), Query Frame = 0 Query: 10 DAFTKRKKLAYLVTVPTALDVGSHTEAGRASGGEVMYDLDTVVHHTSRDRQQGDVEMQKGHYKVYTRISDDKWCRCDDENVSTVHAFAVLTEDAFTLSYAK 110 D FT RK + LV P LD+ +T +A+G ++Y L V+ H +GD ++GHY YT+ S+ +W + DDE+V VL + A+ L Y + Sbjct: 224 DDFTGRK-ITQLVKYPENLDLRPYTS--QAAGEPLLYALYAVLVH------RGD-SCREGHYFCYTKASNGRWYKMDDESVHGCRIGTVLRQQAYLLFYVR 314 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig9055.20997.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig9055.20997.1 ID=prot_M-pyrifera_M_contig9055.20997.1|Name=mRNA_M-pyrifera_M_contig9055.20997.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=113bpback to top |