prot_M-pyrifera_M_contig87721.20378.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig87721.20378.1 vs. uniprot
Match: A0A6B2LJH3_9EUKA (Uncharacterized protein (Fragment) n=1 Tax=Arcella intermedia TaxID=1963864 RepID=A0A6B2LJH3_9EUKA) HSP 1 Score: 57.0 bits (136), Expect = 5.420e-7 Identity = 31/88 (35.23%), Postives = 44/88 (50.00%), Query Frame = 0 Query: 12 ALLDLWFDCGGEDWQYKEGSEPFNRTNPGTWGPDEGDPCEEQWWGVFCNPDNTTVEILYPNSRFSGNPLKGTLPASFGDIQGLKQAYL 99 AL+D + G W N T+P GDPC+ QW+G+ C+P NTTV IL S + L+GT+P+S + L +L Sbjct: 13 ALMDFYNATRGPHWT--------NSTHPWLL----GDPCDSQWYGISCDPTNTTVTILV----LSSHNLEGTVPSSISKLSNLTMLFL 84
BLAST of mRNA_M-pyrifera_M_contig87721.20378.1 vs. uniprot
Match: A0A7S4M514_9EUKA (Hypothetical protein (Fragment) n=1 Tax=Vannella sp. CB-2014 TaxID=1487602 RepID=A0A7S4M514_9EUKA) HSP 1 Score: 53.5 bits (127), Expect = 2.270e-5 Identity = 27/76 (35.53%), Postives = 35/76 (46.05%), Query Frame = 0 Query: 3 AAVSPEVRAALLDLWFD-CGGEDWQYKEGSEPFNRTNPGTWGPDEGDPCEEQWWGVFCNPDNTTVEILYPNSRFSG 77 A +S L+ +D GG DW N G+WG EGDPC+ +W+GV C D T I PN+ G Sbjct: 31 ATISDSAEVTSLNSLYDQLGGPDW-----------NNSGSWG--EGDPCDNEWYGVTCLEDTTVNRIFLPNNNLVG 93 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig87721.20378.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig87721.20378.1 ID=prot_M-pyrifera_M_contig87721.20378.1|Name=mRNA_M-pyrifera_M_contig87721.20378.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=157bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|