prot_M-pyrifera_M_contig8637.20115.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8637.20115.1 vs. uniprot
Match: D8LMZ2_ECTSI (COG2350: Uncharacterized protein conserved in bacteria n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LMZ2_ECTSI) HSP 1 Score: 97.4 bits (241), Expect = 8.340e-22 Identity = 45/84 (53.57%), Postives = 63/84 (75.00%), Query Frame = 0 Query: 2 IFRVRNVGSSLSDEDKIQTGSEDDMRRLMYDLDPDSDEQGPMYFGTDGMDGPEQIWEKAPQEVRFDQCYLAFCVDREETKEEPK 85 + R++NV +++ +ED++ S++ MRRLM+D+DPDS ++GPMYFG GM E K P+EVRF Q YLAFCVDREET++E K Sbjct: 115 LLRLKNVAAAVPEEDRVDDHSDEAMRRLMFDMDPDSKDKGPMYFGDAGMYTDEVNHVKYPEEVRFPQSYLAFCVDREETEDEDK 198
BLAST of mRNA_M-pyrifera_M_contig8637.20115.1 vs. uniprot
Match: A0A6H5JNB6_9PHAE (YCII domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JNB6_9PHAE) HSP 1 Score: 82.4 bits (202), Expect = 1.690e-16 Identity = 41/67 (61.19%), Postives = 50/67 (74.63%), Query Frame = 0 Query: 19 QTGSEDDMRRLMYDLDPDSDEQGPMYFGTDGMDGPEQIWEKAPQEVRFDQCYLAFCVDREETKEEPK 85 Q S++ MRRLM+D+DPDS ++GPMYFG GM E K P+EVRF Q YLAFCVDREET++E K Sbjct: 16 QDHSDEAMRRLMFDMDPDSKDKGPMYFGDAGMYTDEVNHVKYPEEVRFPQSYLAFCVDREETEDEDK 82 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8637.20115.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig8637.20115.1 ID=prot_M-pyrifera_M_contig8637.20115.1|Name=mRNA_M-pyrifera_M_contig8637.20115.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=85bpback to top |