prot_M-pyrifera_M_contig83611.19531.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig83611.19531.1 vs. uniprot
Match: D7FX21_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FX21_ECTSI) HSP 1 Score: 70.5 bits (171), Expect = 4.510e-13 Identity = 29/39 (74.36%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 1 ILFLPCAHQCTCERCGGGYLGKPCIICRTPVEIVQKVIK 39 ILFLPCAHQCTC RCG Y GKPCI+CR V+ VQ+VIK Sbjct: 977 ILFLPCAHQCTCSRCGSAYEGKPCILCRRVVDKVQRVIK 1015
BLAST of mRNA_M-pyrifera_M_contig83611.19531.1 vs. uniprot
Match: A0A6H5JKP4_9PHAE (RING-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JKP4_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 1.900e-12 Identity = 28/39 (71.79%), Postives = 31/39 (79.49%), Query Frame = 0 Query: 1 ILFLPCAHQCTCERCGGGYLGKPCIICRTPVEIVQKVIK 39 ILFLPCAH CTC RCG Y GKPCI+CR V+ VQ+VIK Sbjct: 319 ILFLPCAHHCTCSRCGSAYEGKPCILCRRVVDKVQRVIK 357
BLAST of mRNA_M-pyrifera_M_contig83611.19531.1 vs. uniprot
Match: A0A6H5J8V2_9PHAE (RING-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J8V2_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 2.930e-12 Identity = 28/39 (71.79%), Postives = 31/39 (79.49%), Query Frame = 0 Query: 1 ILFLPCAHQCTCERCGGGYLGKPCIICRTPVEIVQKVIK 39 ILFLPCAHQCTC RCG G++GKPCIICR V Q VI+ Sbjct: 1033 ILFLPCAHQCTCVRCGSGFVGKPCIICRQKVTRAQPVIR 1071 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig83611.19531.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig83611.19531.1 ID=prot_M-pyrifera_M_contig83611.19531.1|Name=mRNA_M-pyrifera_M_contig83611.19531.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=42bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|