prot_M-pyrifera_M_contig83562.19517.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig83562.19517.1 vs. uniprot
Match: M2Y148_GALSU (DNA-directed RNA polymerase III subunit RPC3 n=1 Tax=Galdieria sulphuraria TaxID=130081 RepID=M2Y148_GALSU) HSP 1 Score: 55.1 bits (131), Expect = 4.650e-6 Identity = 27/71 (38.03%), Postives = 41/71 (57.75%), Query Frame = 0 Query: 1 DREKITDLALIPAVIVNERLHRMFKDEYVVLTEIPKTSDYSAEWGASFYLWSVDPRTAQNRLQTELCRTIK 71 ++ ++ + A++P E+L+ MF+D YVV+ EIP +SDY + SF+LWSVD N LC K Sbjct: 367 EQRQLLEFAMLPGTTAREKLYAMFRDGYVVVNEIPSSSDYKSS--RSFFLWSVD---VSNVFTNVLCHAYK 432
BLAST of mRNA_M-pyrifera_M_contig83562.19517.1 vs. uniprot
Match: A0A7I8W2R5_9ANNE (DNA-directed RNA polymerase III subunit RPC3 n=1 Tax=Dimorphilus gyrociliatus TaxID=2664684 RepID=A0A7I8W2R5_9ANNE) HSP 1 Score: 53.9 bits (128), Expect = 1.170e-5 Identity = 30/98 (30.61%), Postives = 58/98 (59.18%), Query Frame = 0 Query: 1 DREKITDLALIPAVIVNERLHRMFKDEYVVLTEIPKTSDYSAEWGASFYLWSVDPRTAQNRLQTELCRTIKRFLQRQKFYYEENKMLLARVAECKAVS 98 +++KI D +IPA E L+RM + +YV +TE+PKTSD++ ++FYL+SV+ +L+ + R+ +++K LL + ++ +A++ Sbjct: 347 EQQKIEDCVMIPAKEAKELLYRMVEQQYVSVTEVPKTSDHAPR--STFYLFSVNIDALARKLEENCYMILGNLYSRRDHEGKKSKRLLEKQSKIEAIA 442 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig83562.19517.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig83562.19517.1 ID=prot_M-pyrifera_M_contig83562.19517.1|Name=mRNA_M-pyrifera_M_contig83562.19517.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=142bpback to top |