prot_M-pyrifera_M_contig83506.19507.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig83506.19507.1 vs. uniprot
Match: A0A5B9MGW5_9BACT (Nickel-containing superoxide dismutase n=4 Tax=Planctomycetes TaxID=203682 RepID=A0A5B9MGW5_9BACT) HSP 1 Score: 59.7 bits (143), Expect = 4.030e-10 Identity = 26/34 (76.47%), Postives = 28/34 (82.35%), Query Frame = 0 Query: 1 MKCTQGVDPKTATTLKKAIFDLYRAYEGKEPHFE 34 MKC Q DP+TA L+KAIFDLYRAYEGKEP FE Sbjct: 117 MKCKQSADPETAKVLEKAIFDLYRAYEGKEPAFE 150
BLAST of mRNA_M-pyrifera_M_contig83506.19507.1 vs. uniprot
Match: A0A517ZH90_9PLAN (Nickel-containing superoxide dismutase n=2 Tax=Symmachiella TaxID=2795780 RepID=A0A517ZH90_9PLAN) HSP 1 Score: 58.2 bits (139), Expect = 1.620e-9 Identity = 25/34 (73.53%), Postives = 28/34 (82.35%), Query Frame = 0 Query: 1 MKCTQGVDPKTATTLKKAIFDLYRAYEGKEPHFE 34 MKC Q VDPK A +L+KAI+D YRAYEGKEP FE Sbjct: 120 MKCKQTVDPKVAESLEKAIYDFYRAYEGKEPDFE 153
BLAST of mRNA_M-pyrifera_M_contig83506.19507.1 vs. uniprot
Match: A0A255R7R1_9BACT (Uncharacterized protein n=2 Tax=Pirellulaceae TaxID=2691357 RepID=A0A255R7R1_9BACT) HSP 1 Score: 57.8 bits (138), Expect = 2.280e-9 Identity = 25/34 (73.53%), Postives = 26/34 (76.47%), Query Frame = 0 Query: 1 MKCTQGVDPKTATTLKKAIFDLYRAYEGKEPHFE 34 MKC Q DP TA L+KAIFD YRAYEGKEP FE Sbjct: 118 MKCKQSADPATAKALEKAIFDFYRAYEGKEPDFE 151
BLAST of mRNA_M-pyrifera_M_contig83506.19507.1 vs. uniprot
Match: A0A5B9QPY4_9BACT (Nickel-containing superoxide dismutase n=1 Tax=Roseimaritima ulvae TaxID=980254 RepID=A0A5B9QPY4_9BACT) HSP 1 Score: 57.8 bits (138), Expect = 2.490e-9 Identity = 25/34 (73.53%), Postives = 27/34 (79.41%), Query Frame = 0 Query: 1 MKCTQGVDPKTATTLKKAIFDLYRAYEGKEPHFE 34 MKC Q DP TA L+K+IFDLYRAYEGKEP FE Sbjct: 123 MKCKQSADPATAKALEKSIFDLYRAYEGKEPAFE 156
BLAST of mRNA_M-pyrifera_M_contig83506.19507.1 vs. uniprot
Match: A0A517NC16_9BACT (Nickel-containing superoxide dismutase n=2 Tax=Rubripirellula lacrimiformis TaxID=1930273 RepID=A0A517NC16_9BACT) HSP 1 Score: 57.4 bits (137), Expect = 3.500e-9 Identity = 25/34 (73.53%), Postives = 27/34 (79.41%), Query Frame = 0 Query: 1 MKCTQGVDPKTATTLKKAIFDLYRAYEGKEPHFE 34 MKC Q DP TA L+K+IFDLYRAYEGKEP FE Sbjct: 123 MKCKQSADPATAAGLEKSIFDLYRAYEGKEPTFE 156
BLAST of mRNA_M-pyrifera_M_contig83506.19507.1 vs. uniprot
Match: A0A7Y2ALH4_9BACT (Uncharacterized protein n=1 Tax=Pirellulaceae bacterium TaxID=2699754 RepID=A0A7Y2ALH4_9BACT) HSP 1 Score: 57.0 bits (136), Expect = 4.450e-9 Identity = 24/34 (70.59%), Postives = 27/34 (79.41%), Query Frame = 0 Query: 1 MKCTQGVDPKTATTLKKAIFDLYRAYEGKEPHFE 34 MKC Q DP TA L+K+IFDLYRAYEGKEP F+ Sbjct: 117 MKCKQSADPDTAKALEKSIFDLYRAYEGKEPDFD 150
BLAST of mRNA_M-pyrifera_M_contig83506.19507.1 vs. uniprot
Match: A0A5M6DLI2_9BACT (Uncharacterized protein n=1 Tax=Roseiconus nitratireducens TaxID=2605748 RepID=A0A5M6DLI2_9BACT) HSP 1 Score: 57.0 bits (136), Expect = 4.450e-9 Identity = 25/34 (73.53%), Postives = 26/34 (76.47%), Query Frame = 0 Query: 1 MKCTQGVDPKTATTLKKAIFDLYRAYEGKEPHFE 34 MKC Q DP TA L+KAIFD YRAYEGKEP FE Sbjct: 117 MKCKQSADPATAEDLEKAIFDFYRAYEGKEPAFE 150
BLAST of mRNA_M-pyrifera_M_contig83506.19507.1 vs. uniprot
Match: A0A517QI89_9PLAN (Nickel-containing superoxide dismutase n=1 Tax=Thalassoglobus polymorphus TaxID=2527994 RepID=A0A517QI89_9PLAN) HSP 1 Score: 57.0 bits (136), Expect = 4.530e-9 Identity = 25/33 (75.76%), Postives = 28/33 (84.85%), Query Frame = 0 Query: 1 MKCTQGVDPKTATTLKKAIFDLYRAYEGKEPHF 33 MK QGVDPK+A +L+KAI DLYRAYEGKEP F Sbjct: 117 MKTKQGVDPKSAQSLRKAILDLYRAYEGKEPKF 149
BLAST of mRNA_M-pyrifera_M_contig83506.19507.1 vs. uniprot
Match: A0A2E7EHY8_9PLAN (Uncharacterized protein n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E7EHY8_9PLAN) HSP 1 Score: 55.8 bits (133), Expect = 1.240e-8 Identity = 24/34 (70.59%), Postives = 25/34 (73.53%), Query Frame = 0 Query: 1 MKCTQGVDPKTATTLKKAIFDLYRAYEGKEPHFE 34 MKC Q VDP TA TL+ AI D YRAYEGKEP E Sbjct: 119 MKCKQSVDPATAATLRSAILDFYRAYEGKEPQIE 152
BLAST of mRNA_M-pyrifera_M_contig83506.19507.1 vs. uniprot
Match: A0A1Z9QMA8_9PLAN (Uncharacterized protein n=4 Tax=Planctomycetia TaxID=203683 RepID=A0A1Z9QMA8_9PLAN) HSP 1 Score: 55.5 bits (132), Expect = 1.750e-8 Identity = 24/33 (72.73%), Postives = 25/33 (75.76%), Query Frame = 0 Query: 1 MKCTQGVDPKTATTLKKAIFDLYRAYEGKEPHF 33 MKC Q DP TA L+K IFDLYRAYEGKEP F Sbjct: 117 MKCKQSADPATAEMLEKKIFDLYRAYEGKEPDF 149 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig83506.19507.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 14
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig83506.19507.1 ID=prot_M-pyrifera_M_contig83506.19507.1|Name=mRNA_M-pyrifera_M_contig83506.19507.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=36bpback to top |