prot_M-pyrifera_M_contig80679.18885.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig80679.18885.1 vs. uniprot
Match: A0A7X7EZI7_9BACT (Uncharacterized protein n=1 Tax=Pirellulaceae bacterium TaxID=2699754 RepID=A0A7X7EZI7_9BACT) HSP 1 Score: 63.5 bits (153), Expect = 3.080e-10 Identity = 26/47 (55.32%), Postives = 35/47 (74.47%), Query Frame = 0 Query: 16 WFLLTDGRSDGRAYFEGYDRQTRRHVGYIGLGGFQESKPTNDEQFPL 62 W+L+ DG SDG A+FEGYD QT+ VGYIG GFQ KP++ ++F + Sbjct: 5 WWLIHDGESDGSAWFEGYDMQTKLRVGYIGRNGFQLEKPSSKDRFSI 51 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig80679.18885.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig80679.18885.1 ID=prot_M-pyrifera_M_contig80679.18885.1|Name=mRNA_M-pyrifera_M_contig80679.18885.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=64bpback to top |