prot_M-pyrifera_M_contig78539.18454.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig78539.18454.1 vs. uniprot
Match: A0A553AJ84_9FLAO (Gliding motility-associated C-terminal domain-containing protein n=1 Tax=Flavobacterium sp. GT3R68 TaxID=2594437 RepID=A0A553AJ84_9FLAO) HSP 1 Score: 53.1 bits (126), Expect = 2.830e-5 Identity = 42/123 (34.15%), Postives = 59/123 (47.97%), Query Frame = 0 Query: 10 AANDLCSDAIQIAASGGVVMGNTGYASNATLLTSSCNGVRLNTIGGVWYTITPAAGTKVLATTCENSFFDTELALLYGGCNEQTCVTADDNACSSYESLSINAEDSALAWTADGSEYLLYVTG 132 A NDLCS AI IA GG T A+ T +C GG+WY+ G V + C S +DT++ ++ G C TCVT +D+ CS+ ++IN+ G Y +YV G Sbjct: 520 ATNDLCSGAIPIAC-GGTATQTTVGATTTGAPTGTCG--TTGGSGGLWYSYV-GTGDVVTFSLC-GSAYDTKIQVVTGACGTFTCVTGNDDFCSTQSQVTINS--------VLGINYYVYVFG 629 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig78539.18454.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig78539.18454.1 ID=prot_M-pyrifera_M_contig78539.18454.1|Name=mRNA_M-pyrifera_M_contig78539.18454.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=147bpback to top |