prot_M-pyrifera_M_contig77796.18301.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig77796.18301.1 vs. uniprot
Match: UPI00190A5CD4 (RICIN domain-containing protein n=1 Tax=Streptomyces sp. MBT65 TaxID=1488395 RepID=UPI00190A5CD4) HSP 1 Score: 51.2 bits (121), Expect = 6.120e-6 Identity = 23/51 (45.10%), Postives = 31/51 (60.78%), Query Frame = 0 Query: 3 NMCLDIEGGGAFAGVPVVLKECNGTNTQKWTMDAQTGLIQSQANTSLCLDA 53 N CLDI G G VV C ++TQ W +DA G++QS A++ LCLD+ Sbjct: 378 NRCLDIRDGDLTEGTDVVTAPCTSSDTQLWRVDAARGVVQSSADSDLCLDS 428
BLAST of mRNA_M-pyrifera_M_contig77796.18301.1 vs. uniprot
Match: A0A7G1NW64_9ACTN (Hydrolase n=2 Tax=Streptomyces aurantiacus group TaxID=2838335 RepID=A0A7G1NW64_9ACTN) HSP 1 Score: 50.8 bits (120), Expect = 8.400e-6 Identity = 25/51 (49.02%), Postives = 34/51 (66.67%), Query Frame = 0 Query: 3 NMCLDIEGGGAFAGVPVVLKECNGTNTQKWTMDAQTGLIQSQANTSLCLDA 53 ++CLDI+GG A AGV L C+ TQKWT + GL++S A+ LCLD+ Sbjct: 398 DLCLDIKGGTAKAGVGAELDTCSAAGTQKWTYEKD-GLLRSAADPGLCLDS 447
BLAST of mRNA_M-pyrifera_M_contig77796.18301.1 vs. uniprot
Match: A0A6B3BYU7_9ACTN (Ricin-type beta-trefoil lectin domain protein n=2 Tax=unclassified Streptomyces TaxID=2593676 RepID=A0A6B3BYU7_9ACTN) HSP 1 Score: 50.4 bits (119), Expect = 1.150e-5 Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 0 Query: 5 CLDIEGGGAFAGVPVVLKECNGTN-TQKWTMDAQTGLIQSQANTSLCLDA 53 CLDI GG G VV C+ + TQ+W +DA +GL++S ANT LCLD+ Sbjct: 418 CLDIRGGELEKGTDVVTATCSASAATQRWQVDAGSGLLRSSANTDLCLDS 467
BLAST of mRNA_M-pyrifera_M_contig77796.18301.1 vs. uniprot
Match: UPI001AD62C77 (ricin-type beta-trefoil lectin domain protein n=2 Tax=Streptomyces TaxID=1883 RepID=UPI001AD62C77) HSP 1 Score: 49.7 bits (117), Expect = 2.140e-5 Identity = 22/49 (44.90%), Postives = 31/49 (63.27%), Query Frame = 0 Query: 5 CLDIEGGGAFAGVPVVLKECNGTNTQKWTMDAQTGLIQSQANTSLCLDA 53 CLDI G G VV C+G+ TQ+W +D G++QS A++ LCLD+ Sbjct: 391 CLDILDGDLSNGTDVVTAPCSGSTTQRWRVDTARGVVQSYADSGLCLDS 439
BLAST of mRNA_M-pyrifera_M_contig77796.18301.1 vs. uniprot
Match: UPI0005BD9EC2 (RICIN domain-containing protein n=1 Tax=Streptomyces xylophagus TaxID=285514 RepID=UPI0005BD9EC2) HSP 1 Score: 49.3 bits (116), Expect = 2.930e-5 Identity = 21/49 (42.86%), Postives = 31/49 (63.27%), Query Frame = 0 Query: 5 CLDIEGGGAFAGVPVVLKECNGTNTQKWTMDAQTGLIQSQANTSLCLDA 53 CLDI G G V+ C+ +NTQ W +D+ G++QS A++ LCLD+ Sbjct: 381 CLDIRDGDLTEGTDVITAACSSSNTQLWRVDSARGVVQSGADSDLCLDS 429
BLAST of mRNA_M-pyrifera_M_contig77796.18301.1 vs. uniprot
Match: A0A250VIJ2_STROL (Hydrolase n=15 Tax=Actinomycetia TaxID=1760 RepID=A0A250VIJ2_STROL) HSP 1 Score: 48.9 bits (115), Expect = 4.010e-5 Identity = 21/52 (40.38%), Postives = 31/52 (59.62%), Query Frame = 0 Query: 2 NNMCLDIEGGGAFAGVPVVLKECNGTNTQKWTMDAQTGLIQSQANTSLCLDA 53 + +CLDI G G VV C TQ+W +D+ G++QS A++ LCLD+ Sbjct: 384 SGLCLDIRDGDLTQGTDVVTAPCTSARTQRWRVDSGRGVLQSYADSDLCLDS 435
BLAST of mRNA_M-pyrifera_M_contig77796.18301.1 vs. uniprot
Match: A0A1H5D535_9ACTN (Ricin-type beta-trefoil lectin domain-containing protein n=4 Tax=Streptomyces TaxID=1883 RepID=A0A1H5D535_9ACTN) HSP 1 Score: 48.5 bits (114), Expect = 5.490e-5 Identity = 20/49 (40.82%), Postives = 29/49 (59.18%), Query Frame = 0 Query: 5 CLDIEGGGAFAGVPVVLKECNGTNTQKWTMDAQTGLIQSQANTSLCLDA 53 CLD+ G G V+ C + TQ W +DA G++QS A++ LCLD+ Sbjct: 395 CLDVRDGDLTEGTDVITASCTSSGTQLWRVDATRGVVQSSADSDLCLDS 443
BLAST of mRNA_M-pyrifera_M_contig77796.18301.1 vs. uniprot
Match: UPI00124AF52A (ricin-type beta-trefoil lectin domain protein n=1 Tax=Streptomyces albicerus TaxID=2569859 RepID=UPI00124AF52A) HSP 1 Score: 48.5 bits (114), Expect = 5.520e-5 Identity = 23/51 (45.10%), Postives = 35/51 (68.63%), Query Frame = 0 Query: 3 NMCLDIEGGGAFAGVPVVLKECNGTNTQKWTMDAQTGLIQSQANTSLCLDA 53 ++CLDI+GG A AGV L+ C+ TQ+W+ + + GL++S N LCLD+ Sbjct: 403 DLCLDIKGGTAKAGVGTKLETCSAAGTQRWSYE-EDGLLRSVDNPELCLDS 452 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig77796.18301.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 8
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig77796.18301.1 ID=prot_M-pyrifera_M_contig77796.18301.1|Name=mRNA_M-pyrifera_M_contig77796.18301.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=60bpback to top |