prot_M-pyrifera_M_contig77763.18292.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig77763.18292.1 vs. uniprot
Match: D7G934_ECTSI (Haloacid dehalogenase-like hydrolase family protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G934_ECTSI) HSP 1 Score: 72.0 bits (175), Expect = 9.350e-14 Identity = 33/43 (76.74%), Postives = 38/43 (88.37%), Query Frame = 0 Query: 1 MAAYVKTRHPDVNTVYMVGEDGLEEELGMVGLKIAKEEARPAP 43 +AAYVK HPDV TVYM+GE+GLEEEL MVGL++ KEEARPAP Sbjct: 103 IAAYVKLSHPDVQTVYMIGEEGLEEELEMVGLRVVKEEARPAP 145 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig77763.18292.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig77763.18292.1 ID=prot_M-pyrifera_M_contig77763.18292.1|Name=mRNA_M-pyrifera_M_contig77763.18292.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=43bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|