prot_M-pyrifera_M_contig77280.18206.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig77280.18206.1 vs. uniprot
Match: UPI001AFB0579 (Uncharacterized protein n=1 Tax=Agreia sp. COWG TaxID=2773266 RepID=UPI001AFB0579) HSP 1 Score: 59.7 bits (143), Expect = 6.920e-11 Identity = 27/37 (72.97%), Postives = 31/37 (83.78%), Query Frame = 0 Query: 1 TREWRNWQTRRLQVPVPERVWGFKSPLAHNGDDVERG 37 +REWRNWQTR LQVPV ER WGFKSPLAH D+++ G Sbjct: 20 SREWRNWQTRWLQVPVLERAWGFKSPLAH-ADNMKAG 55
BLAST of mRNA_M-pyrifera_M_contig77280.18206.1 vs. uniprot
Match: A0A1Y5P2D5_9MICO (Uncharacterized protein n=1 Tax=uncultured Microbacterium sp. TaxID=191216 RepID=A0A1Y5P2D5_9MICO) HSP 1 Score: 58.2 bits (139), Expect = 4.450e-10 Identity = 25/31 (80.65%), Postives = 27/31 (87.10%), Query Frame = 0 Query: 1 TREWRNWQTRRLQVPVPERVWGFKSPLAHNG 31 +REWRN QTR LQVPVPER WGF SPLAH+G Sbjct: 36 SREWRNRQTRWLQVPVPERAWGFNSPLAHSG 66
BLAST of mRNA_M-pyrifera_M_contig77280.18206.1 vs. uniprot
Match: F2RD16_STRVP (Uncharacterized protein n=1 Tax=Streptomyces venezuelae (strain ATCC 10712 / CBS 650.69 / DSM 40230 / JCM 4526 / NBRC 13096 / PD 04745) TaxID=953739 RepID=F2RD16_STRVP) HSP 1 Score: 51.6 bits (122), Expect = 6.960e-8 Identity = 22/28 (78.57%), Postives = 23/28 (82.14%), Query Frame = 0 Query: 2 REWRNWQTRRLQVPVPERVWGFKSPLAH 29 R WRN QTR +QVPVPER WGF SPLAH Sbjct: 2 RGWRNRQTRWIQVPVPERAWGFNSPLAH 29
BLAST of mRNA_M-pyrifera_M_contig77280.18206.1 vs. uniprot
Match: A0A2P2BY16_9ZZZZ (Uncharacterized protein n=1 Tax=metagenome TaxID=256318 RepID=A0A2P2BY16_9ZZZZ) HSP 1 Score: 52.4 bits (124), Expect = 1.130e-6 Identity = 23/30 (76.67%), Postives = 24/30 (80.00%), Query Frame = 0 Query: 1 TREWRNWQTRRLQVPVPERVWGFKSPLAHN 30 TREWRN QTR +QV V ER WGF SPLAHN Sbjct: 224 TREWRNRQTRTVQVRVSERTWGFNSPLAHN 253
BLAST of mRNA_M-pyrifera_M_contig77280.18206.1 vs. uniprot
Match: A0A173LYG4_9MICO (Uncharacterized protein n=1 Tax=Aurantimicrobium minutum TaxID=708131 RepID=A0A173LYG4_9MICO) HSP 1 Score: 48.9 bits (115), Expect = 1.770e-6 Identity = 20/23 (86.96%), Postives = 20/23 (86.96%), Query Frame = 0 Query: 7 WQTRRLQVPVPERVWGFKSPLAH 29 WQTR LQVPVP R WGFKSPLAH Sbjct: 15 WQTRWLQVPVPARAWGFKSPLAH 37
BLAST of mRNA_M-pyrifera_M_contig77280.18206.1 vs. uniprot
Match: A0A1V1W0M9_9ACTN (Ph-response regulator protein palh rim21 n=1 Tax=Nocardioides sp. PD653 TaxID=393303 RepID=A0A1V1W0M9_9ACTN) HSP 1 Score: 45.8 bits (107), Expect = 5.720e-5 Identity = 22/30 (73.33%), Postives = 23/30 (76.67%), Query Frame = 0 Query: 8 QTRRLQVPVPERVWGFKSPLAH---NGDDV 34 QTR LQVPV ER WGFKSPLAH GDD+ Sbjct: 65 QTRWLQVPVSERAWGFKSPLAHVSSPGDDL 94 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig77280.18206.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig77280.18206.1 ID=prot_M-pyrifera_M_contig77280.18206.1|Name=mRNA_M-pyrifera_M_contig77280.18206.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=45bpback to top |