prot_M-pyrifera_M_contig76646.18060.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig76646.18060.1 vs. uniprot
Match: D8LMY2_ECTSI (CSN8_PSD8_EIF3K domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LMY2_ECTSI) HSP 1 Score: 78.6 bits (192), Expect = 2.450e-16 Identity = 39/64 (60.94%), Postives = 48/64 (75.00%), Query Frame = 0 Query: 4 RRDVQGAQGALRGREWGANIAPFIALVGDRLWERQLSIISKAFTALPLERVASMLGCGVADAEQ 67 +RD+ AQ ALR REW A +AP++AL+ R+ ERQL+II KAFT LPLE VA ML C V DAE+ Sbjct: 97 KRDMSFAQAALRDREWSAPLAPYVALIETRVRERQLAIIPKAFTVLPLESVAGMLACSVEDAEK 160 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig76646.18060.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig76646.18060.1 ID=prot_M-pyrifera_M_contig76646.18060.1|Name=mRNA_M-pyrifera_M_contig76646.18060.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=68bpback to top |