prot_M-pyrifera_M_contig7641.18015.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7641.18015.1 vs. uniprot
Match: D7FSE6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FSE6_ECTSI) HSP 1 Score: 108 bits (270), Expect = 3.690e-29 Identity = 47/65 (72.31%), Postives = 56/65 (86.15%), Query Frame = 0 Query: 1 METHAPSRLPPGFSVKRFADLPSCRDFIHSAGGTLVGVEIGDGAKNVDEDPFTGTCAFMAGNEAS 65 +ETHAP LPPG + RF+DLPSCRD++HS GGTL+GVEIG GA+N+DE+PF GTCAFM GNEAS Sbjct: 52 IETHAPRGLPPGITFTRFSDLPSCRDYVHSRGGTLIGVEIGGGARNIDEEPFLGTCAFMPGNEAS 116
BLAST of mRNA_M-pyrifera_M_contig7641.18015.1 vs. uniprot
Match: A0A6H5KWR0_9PHAE (SpoU_methylase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KWR0_9PHAE) HSP 1 Score: 107 bits (266), Expect = 1.560e-27 Identity = 46/65 (70.77%), Postives = 55/65 (84.62%), Query Frame = 0 Query: 1 METHAPSRLPPGFSVKRFADLPSCRDFIHSAGGTLVGVEIGDGAKNVDEDPFTGTCAFMAGNEAS 65 +ETHAP LPPG + RF+DLPSCRD++HS GGTL+GVEIG GA+N+DE+PF GTCAFM GNE S Sbjct: 47 IETHAPRGLPPGITFTRFSDLPSCRDYVHSRGGTLIGVEIGGGARNIDEEPFLGTCAFMPGNEGS 111 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7641.18015.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig7641.18015.1 ID=prot_M-pyrifera_M_contig7641.18015.1|Name=mRNA_M-pyrifera_M_contig7641.18015.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=65bpback to top |