prot_M-pyrifera_M_contig74848.17694.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74848.17694.1 vs. uniprot
Match: A0A5J4WPC7_9EUKA (Putative Cleavage and polyadenylation specificity factor subunit 4 n=1 Tax=Streblomastix strix TaxID=222440 RepID=A0A5J4WPC7_9EUKA) HSP 1 Score: 51.6 bits (122), Expect = 9.320e-6 Identity = 26/84 (30.95%), Postives = 36/84 (42.86%), Query Frame = 0 Query: 1 VCKFWLQGKCRKDTKCEFLHLYELPLMPECRNGRS---CGTRDCPFRHTGVDASLEPPALCLRFLDGYCPEGDRCGYLHVQLPP 81 VCK W LHL ++ LMPEC+ S C DC FRH + + C+ + G+C G +C H + P Sbjct: 54 VCKHWFXXXXXXXXXXXXLHLLDMQLMPECQYFASNGICTKEDCAFRHVTPEDKIHE---CVWYNRGFCSHGPKCKSKHARKQP 134 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74848.17694.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig74848.17694.1 ID=prot_M-pyrifera_M_contig74848.17694.1|Name=mRNA_M-pyrifera_M_contig74848.17694.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=88bpback to top |