prot_M-pyrifera_M_contig73529.17426.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig73529.17426.1 vs. uniprot
Match: A0A5A8DGJ0_CAFRO (Uncharacterized protein n=1 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8DGJ0_CAFRO) HSP 1 Score: 55.1 bits (131), Expect = 2.720e-6 Identity = 28/44 (63.64%), Postives = 32/44 (72.73%), Query Frame = 0 Query: 3 GQGLSDAAFHGDIAAIDRLL-ESGARIDAKDGDGFTALHRACVT 45 GQ LSDAAF GD A +D LL E ++ KD DGFTALHR+CVT Sbjct: 69 GQLLSDAAFSGDTAKVDHLLREKKIPVNCKDNDGFTALHRSCVT 112
BLAST of mRNA_M-pyrifera_M_contig73529.17426.1 vs. uniprot
Match: A0A5A8D5Z1_CAFRO (Uncharacterized protein n=1 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8D5Z1_CAFRO) HSP 1 Score: 55.1 bits (131), Expect = 2.750e-6 Identity = 28/44 (63.64%), Postives = 32/44 (72.73%), Query Frame = 0 Query: 3 GQGLSDAAFHGDIAAIDRLL-ESGARIDAKDGDGFTALHRACVT 45 GQ LSDAAF GD A +D LL E ++ KD DGFTALHR+CVT Sbjct: 495 GQLLSDAAFSGDTAKVDHLLREKKIPVNCKDNDGFTALHRSCVT 538
BLAST of mRNA_M-pyrifera_M_contig73529.17426.1 vs. uniprot
Match: A0A5A8EGP8_CAFRO (Uncharacterized protein n=8 Tax=Sar TaxID=2698737 RepID=A0A5A8EGP8_CAFRO) HSP 1 Score: 55.1 bits (131), Expect = 2.810e-6 Identity = 28/44 (63.64%), Postives = 32/44 (72.73%), Query Frame = 0 Query: 3 GQGLSDAAFHGDIAAIDRLL-ESGARIDAKDGDGFTALHRACVT 45 GQ LSDAAF GD A +D LL E ++ KD DGFTALHR+CVT Sbjct: 3836 GQLLSDAAFSGDTAKVDHLLREKKIPVNCKDNDGFTALHRSCVT 3879 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig73529.17426.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig73529.17426.1 ID=prot_M-pyrifera_M_contig73529.17426.1|Name=mRNA_M-pyrifera_M_contig73529.17426.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=121bpback to top |