prot_M-pyrifera_M_contig7345.17414.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7345.17414.1 vs. uniprot
Match: A0A6H5JEC1_9PHAE (FAD_binding_8 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JEC1_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 5.830e-12 Identity = 31/51 (60.78%), Postives = 36/51 (70.59%), Query Frame = 0 Query: 15 RVYFYHVNGCLFLRTAVCRGYQFKVGAYIQVNCPAISATQWHPFSLFPVPG 65 R F V +R + GYQF VG+YIQVNCPAISA +WHPFS+FPVPG Sbjct: 435 RAVFRPVGRATLVRFDLPPGYQFNVGSYIQVNCPAISAKEWHPFSMFPVPG 485
BLAST of mRNA_M-pyrifera_M_contig7345.17414.1 vs. uniprot
Match: D7G8C4_ECTSI (Putative respiratory burst oxidase homolog n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G8C4_ECTSI) HSP 1 Score: 68.6 bits (166), Expect = 5.860e-12 Identity = 28/32 (87.50%), Postives = 31/32 (96.88%), Query Frame = 0 Query: 34 GYQFKVGAYIQVNCPAISATQWHPFSLFPVPG 65 GYQFKVG+YIQVNCPAISA +WHPFS+FPVPG Sbjct: 221 GYQFKVGSYIQVNCPAISAKEWHPFSMFPVPG 252
BLAST of mRNA_M-pyrifera_M_contig7345.17414.1 vs. uniprot
Match: D7G8C8_ECTSI (Putative respiratory burst oxidase protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G8C8_ECTSI) HSP 1 Score: 67.0 bits (162), Expect = 2.060e-11 Identity = 35/61 (57.38%), Postives = 42/61 (68.85%), Query Frame = 0 Query: 5 TAQRKTLDSSRVYFYHVNGCLFLRTAVCRGYQFKVGAYIQVNCPAISATQWHPFSLFPVPG 65 T + L SS VY G L +R + GYQ+K GAY+QVNCPAIS ++WHPFSLFPVPG Sbjct: 438 TTKMTFLLSSPVYKPVGRGTL-VRFELPPGYQYKPGAYVQVNCPAISVSEWHPFSLFPVPG 497
BLAST of mRNA_M-pyrifera_M_contig7345.17414.1 vs. uniprot
Match: A0A6H5JHI2_9PHAE (FAD-binding FR-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHI2_9PHAE) HSP 1 Score: 67.0 bits (162), Expect = 2.060e-11 Identity = 35/61 (57.38%), Postives = 42/61 (68.85%), Query Frame = 0 Query: 5 TAQRKTLDSSRVYFYHVNGCLFLRTAVCRGYQFKVGAYIQVNCPAISATQWHPFSLFPVPG 65 T + L SS VY G L +R + GYQ+K GAY+QVNCPAIS ++WHPFSLFPVPG Sbjct: 450 TTKMTFLLSSPVYKPVGRGTL-VRFELPPGYQYKPGAYVQVNCPAISVSEWHPFSLFPVPG 509
BLAST of mRNA_M-pyrifera_M_contig7345.17414.1 vs. uniprot
Match: D7G8D0_ECTSI (Putative respiratory burst oxidase homolog protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G8D0_ECTSI) HSP 1 Score: 62.8 bits (151), Expect = 2.370e-11 Identity = 24/32 (75.00%), Postives = 30/32 (93.75%), Query Frame = 0 Query: 34 GYQFKVGAYIQVNCPAISATQWHPFSLFPVPG 65 GY+++ GAY+QVNCPAIS ++WHPFSLFPVPG Sbjct: 5 GYKYQPGAYVQVNCPAISVSEWHPFSLFPVPG 36
BLAST of mRNA_M-pyrifera_M_contig7345.17414.1 vs. uniprot
Match: A0A8N5HSZ9_GEOFO (NADPH oxidase 1 n=1 Tax=Geospiza fortis TaxID=48883 RepID=A0A8N5HSZ9_GEOFO) HSP 1 Score: 48.1 bits (113), Expect = 9.310e-5 Identity = 19/32 (59.38%), Postives = 25/32 (78.12%), Query Frame = 0 Query: 33 RGYQFKVGAYIQVNCPAISATQWHPFSLFPVP 64 +G++ +VG YI VNCPAISA +WHPF+L P Sbjct: 385 KGFRMEVGQYIFVNCPAISALEWHPFTLTSAP 416 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7345.17414.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 6
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig7345.17414.1 ID=prot_M-pyrifera_M_contig7345.17414.1|Name=mRNA_M-pyrifera_M_contig7345.17414.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=65bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|