prot_M-pyrifera_M_contig72255.17182.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig72255.17182.1 vs. uniprot
Match: L8HD38_ACACA (Calpain large subunit, domain iii domain containing protein n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8HD38_ACACA) HSP 1 Score: 104 bits (259), Expect = 1.320e-23 Identity = 46/120 (38.33%), Postives = 79/120 (65.83%), Query Frame = 0 Query: 5 SRQTIGLISIPLKGVPFMHSSMTFGVMRSYAWTPVHK------LGGSLRIGLKLTKTPNVTKLDDSWTPKCSGGDLDHNTWIRSPQYFMTVNAESLVAFTLRSQVGAEHSMGFYVLRLKD 118 + +G++SIPLK +PF+H SM FG+ + Y + P K GG LRIGLKL K + T+ W K +GG L+++TW+ +PQY+++V+ S+++ L+S +G E+ +GFY++++ + Sbjct: 97 TNHAMGVVSIPLKDIPFVHESMAFGLAKYYEFKPTSKDGITSVPGGMLRIGLKLLKQRHPTRKLGEWRGKSAGGCLNNHTWVDNPQYWLSVSVRSIISVNLQSTLGKENQLGFYIIKIAE 216 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig72255.17182.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig72255.17182.1 ID=prot_M-pyrifera_M_contig72255.17182.1|Name=mRNA_M-pyrifera_M_contig72255.17182.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=118bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|