Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 109..112 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 1..89 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 90..108 |
None | No IPR available | TMHMM | TMhelix | | coord: 83..105 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig72254.17181.1 ID=prot_M-pyrifera_M_contig72254.17181.1|Name=mRNA_M-pyrifera_M_contig72254.17181.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=113bp FGGYGFSDVLEVPFSFVTGQSVSIRAEMDAYGRASASGSGAGLDWTSDGG NSAYWLGLSDVTIGGSPVNNVTFLDTDTGANLALASTVPLPAPLALLTIG VSILLGAWRSRN* back to top
|