prot_M-pyrifera_M_contig71976.17139.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig71976.17139.1 vs. uniprot
Match: A0A1G3AF20_9BACT (Uncharacterized protein n=1 Tax=Planctomycetes bacterium RBG_16_64_12 TaxID=1801971 RepID=A0A1G3AF20_9BACT) HSP 1 Score: 52.0 bits (123), Expect = 5.770e-6 Identity = 37/116 (31.90%), Postives = 67/116 (57.76%), Query Frame = 0 Query: 3 EAYVAAALAGKSDEAKALIAKETKHAKRLKSEKWLKQFRAIVGEKKIKIESIRVYESAGT--GLAVSEPRKLTKSHPEFGDTGCVVLQLKRKDDQ-WLVRDVDIWSQANSAKALER 115 +A++AAALAGK DEA AL + ++++ + R + KK+ + S+ E+ LA++E ++ K +P+ +TG +V+ L ++DD+ WLV+D+D S+ L+R Sbjct: 11 QAFLAAALAGKVDEAAALADGDQLPVEQIR------ELRDQIKAKKVTVVSVLASETGPRKQALAITESVQVAKPNPDGRNTGKLVIALAKQDDRGWLVQDIDFESEDAVKGELDR 120 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig71976.17139.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig71976.17139.1 ID=prot_M-pyrifera_M_contig71976.17139.1|Name=mRNA_M-pyrifera_M_contig71976.17139.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=116bpback to top |