prot_M-pyrifera_M_contig71813.17108.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig71813.17108.1 vs. uniprot
Match: D7FQJ6_ECTSI (Early-responsive to dehydration protein-related n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FQJ6_ECTSI) HSP 1 Score: 106 bits (264), Expect = 8.110e-25 Identity = 52/76 (68.42%), Postives = 62/76 (81.58%), Query Frame = 0 Query: 11 QVFALFTPYGLLVLIPVNIKAVPVGSQDVRHESSINTFNQLSMSNIQHYDSRMWLHALGVYLLSTLAMHFLVVEYR 86 +VFALF PYGLLVLIPVN+ P S +++INTFN+LSMSN+QHY+ MWLHALG+YLLS LAM+FLVVEYR Sbjct: 137 KVFALFAPYGLLVLIPVNVMETPSDSNQA--QTNINTFNRLSMSNVQHYNPCMWLHALGIYLLSALAMYFLVVEYR 210
BLAST of mRNA_M-pyrifera_M_contig71813.17108.1 vs. uniprot
Match: A0A836CHQ4_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CHQ4_9STRA) HSP 1 Score: 57.4 bits (137), Expect = 1.240e-7 Identity = 30/52 (57.69%), Postives = 37/52 (71.15%), Query Frame = 0 Query: 11 QVFALFTPYGLLVLIPVNIKAVPVGSQDVRHESSINTFNQLSMSNIQHYDSR 62 +VF +F YGL V+IP NI S R ++SIN+FNQLSMSNIQHYDS+ Sbjct: 143 KVFGIFALYGLAVIIPANIAGGQRNS--FRVQTSINSFNQLSMSNIQHYDSK 192 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig71813.17108.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig71813.17108.1 ID=prot_M-pyrifera_M_contig71813.17108.1|Name=mRNA_M-pyrifera_M_contig71813.17108.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=87bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|