prot_M-pyrifera_M_contig69984.16747.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig69984.16747.1 vs. uniprot
Match: K5D638_RHOBT (Uncharacterized protein n=2 Tax=Rhodopirellula baltica TaxID=265606 RepID=K5D638_RHOBT) HSP 1 Score: 67.8 bits (164), Expect = 7.810e-14 Identity = 36/48 (75.00%), Postives = 38/48 (79.17%), Query Frame = 0 Query: 1 MRQDGVDQNRRLAIFPVPPLSKSLRHSFKGLSKGLQRGKQVEVSFETF 48 MR VDQNRRLAIFPVPPLSK+LR S K S LQRGKQVEVS ET+ Sbjct: 1 MRLIEVDQNRRLAIFPVPPLSKALRGSSKEPSSVLQRGKQVEVSSETY 48 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig69984.16747.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig69984.16747.1 ID=prot_M-pyrifera_M_contig69984.16747.1|Name=mRNA_M-pyrifera_M_contig69984.16747.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=49bpback to top |