prot_M-pyrifera_M_contig69796.16714.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig69796.16714.1 vs. uniprot
Match: H6SIB0_PARPM (Uncharacterized protein n=2 Tax=Pararhodospirillum photometricum DSM 122 TaxID=1150469 RepID=H6SIB0_PARPM) HSP 1 Score: 74.3 bits (181), Expect = 3.440e-16 Identity = 35/44 (79.55%), Postives = 36/44 (81.82%), Query Frame = 0 Query: 1 GFPHSEITGSKGALASPVLIAECHVFHRLLPPRHPPDALLTLDR 44 G PHSEI GSK AL SP LIAECHV HRLL PRHPPDALL LD+ Sbjct: 10 GLPHSEIHGSKPALGSPWLIAECHVLHRLLTPRHPPDALLLLDK 53
BLAST of mRNA_M-pyrifera_M_contig69796.16714.1 vs. uniprot
Match: A0A5E7ZEP0_9RHOB (Uncharacterized protein n=1 Tax=Roseovarius sp. EC-HK134 TaxID=2038394 RepID=A0A5E7ZEP0_9RHOB) HSP 1 Score: 60.1 bits (144), Expect = 7.560e-11 Identity = 30/43 (69.77%), Postives = 33/43 (76.74%), Query Frame = 0 Query: 1 GFPHSEITGSKGALASPVLIAECHVFHRLLPPRHPPDALLTLD 43 G PHSEI GS+ L+S LIAE HV HRLL PRHPP+ALL LD Sbjct: 31 GLPHSEIHGSQLILSSSWLIAEYHVLHRLLLPRHPPNALLALD 73
BLAST of mRNA_M-pyrifera_M_contig69796.16714.1 vs. uniprot
Match: D4CI29_9CLOT (Uncharacterized protein n=1 Tax=Clostridium sp. M62/1 TaxID=411486 RepID=D4CI29_9CLOT) HSP 1 Score: 58.5 bits (140), Expect = 1.660e-10 Identity = 27/42 (64.29%), Postives = 32/42 (76.19%), Query Frame = 0 Query: 1 GFPHSEITGSKGALASPVLIAECHVFHRLLPPRHPPDALLTL 42 GFPHS+I+GS +SP L A HVFHRLL PRHPP AL++L Sbjct: 8 GFPHSDISGSMDICSSPKLFAAYHVFHRLLVPRHPPCALISL 49
BLAST of mRNA_M-pyrifera_M_contig69796.16714.1 vs. uniprot
Match: A5KR92_9FIRM (Uncharacterized protein n=2 Tax=[Ruminococcus] torques ATCC 27756 TaxID=411460 RepID=A5KR92_9FIRM) HSP 1 Score: 59.3 bits (142), Expect = 5.490e-10 Identity = 27/43 (62.79%), Postives = 32/43 (74.42%), Query Frame = 0 Query: 2 FPHSEITGSKGALASPVLIAECHVFHRLLPPRHPPDALLTLDR 44 FPHSEI+GS G SP L A HVFHRLL PRHPP AL+++ + Sbjct: 90 FPHSEISGSMGICPSPKLFAAYHVFHRLLVPRHPPYALISITK 132
BLAST of mRNA_M-pyrifera_M_contig69796.16714.1 vs. uniprot
Match: B5CMS1_9FIRM (Uncharacterized protein n=1 Tax=[Ruminococcus] lactaris ATCC 29176 TaxID=471875 RepID=B5CMS1_9FIRM) HSP 1 Score: 58.5 bits (140), Expect = 8.530e-10 Identity = 27/41 (65.85%), Postives = 31/41 (75.61%), Query Frame = 0 Query: 2 FPHSEITGSKGALASPVLIAECHVFHRLLPPRHPPDALLTL 42 FPHSEI+GS G SP L A HVFHRLL PRHPP AL+++ Sbjct: 65 FPHSEISGSMGICPSPKLFAAYHVFHRLLVPRHPPYALISI 105
BLAST of mRNA_M-pyrifera_M_contig69796.16714.1 vs. uniprot
Match: A5Z301_9FIRM (Uncharacterized protein n=3 Tax=Eubacterium ventriosum ATCC 27560 TaxID=411463 RepID=A5Z301_9FIRM) HSP 1 Score: 53.5 bits (127), Expect = 1.350e-7 Identity = 26/42 (61.90%), Postives = 30/42 (71.43%), Query Frame = 0 Query: 1 GFPHSEITGSKGALASPVLIAECHVFHRLLPPRHPPDALLTL 42 GFPHS+I GS +SP L A HVF RLL PRHPP AL++L Sbjct: 38 GFPHSDICGSMDICSSPQLFAAYHVFLRLLVPRHPPCALISL 79
BLAST of mRNA_M-pyrifera_M_contig69796.16714.1 vs. uniprot
Match: UPI001E3258DF (hypothetical protein n=1 Tax=Paenihalocynthiibacter styelae TaxID=2761955 RepID=UPI001E3258DF) HSP 1 Score: 46.2 bits (108), Expect = 1.650e-5 Identity = 21/25 (84.00%), Postives = 22/25 (88.00%), Query Frame = 0 Query: 19 LIAECHVFHRLLPPRHPPDALLTLD 43 LIAE HVFHRLL PRHPP+AL TLD Sbjct: 2 LIAEYHVFHRLLLPRHPPNALFTLD 26
BLAST of mRNA_M-pyrifera_M_contig69796.16714.1 vs. uniprot
Match: A0A6A5L4G5_LUPAL (Uncharacterized protein n=1 Tax=Lupinus albus TaxID=3870 RepID=A0A6A5L4G5_LUPAL) HSP 1 Score: 47.4 bits (111), Expect = 7.020e-5 Identity = 22/38 (57.89%), Postives = 27/38 (71.05%), Query Frame = 0 Query: 6 EITGSKGALASPVLIAECHVFHRLLPPRHPPDALLTLD 43 +++ + A SP LIA C+V HRL PRHPPDAL TLD Sbjct: 151 DVSVRRPARGSPKLIATCYVLHRLSVPRHPPDALQTLD 188 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig69796.16714.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 8
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig69796.16714.1 ID=prot_M-pyrifera_M_contig69796.16714.1|Name=mRNA_M-pyrifera_M_contig69796.16714.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=44bpback to top |