prot_M-pyrifera_M_contig69674.16692.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig69674.16692.1 vs. uniprot
Match: A0A6H5JMA1_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JMA1_9PHAE) HSP 1 Score: 57.0 bits (136), Expect = 4.510e-7 Identity = 32/101 (31.68%), Postives = 55/101 (54.46%), Query Frame = 0 Query: 32 LVRMGNERMPERVVFGEVEGGKGYLGGQEQGWMGCINGEHDLSLFDLPTEET--QWTLVAKKSGKWFRGVEETAEQYMKRCFVKKKENVAKRRALEGKNAQ 130 ++RM + R+P+R++ GE+ GG GY GGQE W+ + DL F + E+ +W AK W+ +E+ A +M++ ++ E AKR + A+ Sbjct: 141 IMRMEDNRLPKRMLLGEMAGGAGYRGGQESDWVYRLG--EDLVAFGMKEEKEGGRWKESAKDQEAWYDKIEDGAAWFMRKWHRQEAEASAKRXXXRAEEAE 239
BLAST of mRNA_M-pyrifera_M_contig69674.16692.1 vs. uniprot
Match: A0A6H5L144_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L144_9PHAE) HSP 1 Score: 54.7 bits (130), Expect = 5.250e-6 Identity = 27/81 (33.33%), Postives = 47/81 (58.02%), Query Frame = 0 Query: 31 WLVRMGNERMPERVVFGEVEGGKGYLGGQEQGWMGCINGEHDLSLFDLPTEET--QWTLVAKKSGKWFRGVEETAEQYMKR 109 +++RMG+ R+P+R++ G + GG GY GGQE W+ + DL F + E+ +W AK W+ +E+ A +M++ Sbjct: 801 FVMRMGDNRLPKRMLLGAMAGGTGYRGGQESDWVYRLG--EDLVAFGMKEEKEGGRWKESAKDQEAWYDKIEDGAAWFMRK 879 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig69674.16692.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig69674.16692.1 ID=prot_M-pyrifera_M_contig69674.16692.1|Name=mRNA_M-pyrifera_M_contig69674.16692.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=133bpback to top |