prot_M-pyrifera_M_contig69583.16678.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig69583.16678.1 vs. uniprot
Match: A0DDN7_PARTE (RING-type domain-containing protein n=1 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0DDN7_PARTE) HSP 1 Score: 57.0 bits (136), Expect = 4.540e-8 Identity = 22/36 (61.11%), Postives = 26/36 (72.22%), Query Frame = 0 Query: 10 SRACKHVLCTACWTQWLSKRLECPLCRAKCRERYLI 45 S C HV C CW QWL +LECPLCRA+ RE++LI Sbjct: 793 SEKCGHVACQDCWKQWLQTKLECPLCRARVREKFLI 828
BLAST of mRNA_M-pyrifera_M_contig69583.16678.1 vs. uniprot
Match: A0E8J9_PARTE (RING-type domain-containing protein n=1 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0E8J9_PARTE) HSP 1 Score: 57.0 bits (136), Expect = 4.540e-8 Identity = 22/36 (61.11%), Postives = 26/36 (72.22%), Query Frame = 0 Query: 10 SRACKHVLCTACWTQWLSKRLECPLCRAKCRERYLI 45 S C HV C CW QWL +LECPLCRA+ RE++LI Sbjct: 797 SEKCGHVACQDCWKQWLQTKLECPLCRARVREKFLI 832
BLAST of mRNA_M-pyrifera_M_contig69583.16678.1 vs. uniprot
Match: A0A2A9M7M1_9APIC (DNA helicase n=1 Tax=Besnoitia besnoiti TaxID=94643 RepID=A0A2A9M7M1_9APIC) HSP 1 Score: 54.7 bits (130), Expect = 2.990e-7 Identity = 22/42 (52.38%), Postives = 29/42 (69.05%), Query Frame = 0 Query: 6 PWAMSRACKHVLCTACWTQWLSKRLECPLCRAKCRERYLIPS 47 P S C H C ACWT L +RLECP+CRA+ RE++L+P+ Sbjct: 1547 PLHRSLNCGHEFCLACWTAQLQRRLECPVCRARTREKHLVPA 1588
BLAST of mRNA_M-pyrifera_M_contig69583.16678.1 vs. uniprot
Match: F0V878_NEOCL (DNA helicase n=1 Tax=Neospora caninum (strain Liverpool) TaxID=572307 RepID=F0V878_NEOCL) HSP 1 Score: 53.5 bits (127), Expect = 7.650e-7 Identity = 21/42 (50.00%), Postives = 28/42 (66.67%), Query Frame = 0 Query: 6 PWAMSRACKHVLCTACWTQWLSKRLECPLCRAKCRERYLIPS 47 P S C H C CWT+ L RLECP+CRA+ RE++L+P+ Sbjct: 1628 PLHRSLNCGHEFCLVCWTEQLKNRLECPVCRARTREKHLVPA 1669
BLAST of mRNA_M-pyrifera_M_contig69583.16678.1 vs. uniprot
Match: F0ZD88_DICPU (RING-type domain-containing protein (Fragment) n=1 Tax=Dictyostelium purpureum TaxID=5786 RepID=F0ZD88_DICPU) HSP 1 Score: 48.5 bits (114), Expect = 3.330e-6 Identity = 18/34 (52.94%), Postives = 22/34 (64.71%), Query Frame = 0 Query: 13 CKHVLCTACWTQWLSKRLECPLCRAKCRERYLIP 46 C HV C CW QWLS +LECP+CR + R + P Sbjct: 17 CNHVCCYECWNQWLSLKLECPVCRERTRVKQCKP 50
BLAST of mRNA_M-pyrifera_M_contig69583.16678.1 vs. uniprot
Match: D3BQU7_POLPP (RING-type domain-containing protein n=1 Tax=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) TaxID=670386 RepID=D3BQU7_POLPP) HSP 1 Score: 49.7 bits (117), Expect = 5.100e-6 Identity = 19/34 (55.88%), Postives = 23/34 (67.65%), Query Frame = 0 Query: 13 CKHVLCTACWTQWLSKRLECPLCRAKCRERYLIP 46 C HV C CW QWLS +LECP+CR K R + + P Sbjct: 102 CGHVCCWDCWNQWLSLKLECPICREKTRLKQIKP 135
BLAST of mRNA_M-pyrifera_M_contig69583.16678.1 vs. uniprot
Match: Q54ML7_DICDI (RING-type domain-containing protein n=1 Tax=Dictyostelium discoideum TaxID=44689 RepID=Q54ML7_DICDI) HSP 1 Score: 50.4 bits (119), Expect = 9.270e-6 Identity = 18/34 (52.94%), Postives = 22/34 (64.71%), Query Frame = 0 Query: 13 CKHVLCTACWTQWLSKRLECPLCRAKCRERYLIP 46 C H C CW QWLS +LECP+CR +CR + P Sbjct: 471 CNHTCCFECWNQWLSLKLECPVCRERCRIKQCKP 504
BLAST of mRNA_M-pyrifera_M_contig69583.16678.1 vs. uniprot
Match: A0A2C6KJT7_9APIC (Helicase n=1 Tax=Cystoisospora suis TaxID=483139 RepID=A0A2C6KJT7_9APIC) HSP 1 Score: 48.5 bits (114), Expect = 4.480e-5 Identity = 17/38 (44.74%), Postives = 25/38 (65.79%), Query Frame = 0 Query: 10 SRACKHVLCTACWTQWLSKRLECPLCRAKCRERYLIPS 47 S C H C CW L +RLECP+CR + RE++++P+ Sbjct: 738 SLKCGHEFCQTCWLSQLKRRLECPVCRERTREKHIVPA 775
BLAST of mRNA_M-pyrifera_M_contig69583.16678.1 vs. uniprot
Match: A0A8J4PKK7_9MYCE (RING-type domain-containing protein n=1 Tax=Polysphondylium violaceum TaxID=133409 RepID=A0A8J4PKK7_9MYCE) HSP 1 Score: 48.1 bits (113), Expect = 6.070e-5 Identity = 17/34 (50.00%), Postives = 23/34 (67.65%), Query Frame = 0 Query: 13 CKHVLCTACWTQWLSKRLECPLCRAKCRERYLIP 46 C H+ C CW QWLS +LECP+CR + R + + P Sbjct: 397 CGHICCFECWCQWLSLKLECPVCRERARIKLIKP 430
BLAST of mRNA_M-pyrifera_M_contig69583.16678.1 vs. uniprot
Match: UPI000644AA0C (hypothetical protein n=1 Tax=Acytostelium subglobosum LB1 TaxID=1410327 RepID=UPI000644AA0C) HSP 1 Score: 47.8 bits (112), Expect = 8.320e-5 Identity = 18/34 (52.94%), Postives = 23/34 (67.65%), Query Frame = 0 Query: 13 CKHVLCTACWTQWLSKRLECPLCRAKCRERYLIP 46 C H+ C CW QWLS +LECP+CR K R + + P Sbjct: 460 CGHICCWECWGQWLSIKLECPVCREKTRLKQVKP 493 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig69583.16678.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 10
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig69583.16678.1 ID=prot_M-pyrifera_M_contig69583.16678.1|Name=mRNA_M-pyrifera_M_contig69583.16678.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=55bpback to top |