prot_M-pyrifera_M_contig69521.16669.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig69521.16669.1 vs. uniprot
Match: A0A355G6N0_9PLAN (Uncharacterized protein (Fragment) n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A355G6N0_9PLAN) HSP 1 Score: 56.6 bits (135), Expect = 8.320e-10 Identity = 24/36 (66.67%), Postives = 31/36 (86.11%), Query Frame = 0 Query: 1 MPTRKKIQPGEKVPFKLTVAEWKMVLEDLTCLDQNY 36 M T+K+IQPGEK+P KLT AE K++L+DL CLDQ+Y Sbjct: 1 MSTQKQIQPGEKIPLKLTAAERKLILDDLLCLDQDY 36
BLAST of mRNA_M-pyrifera_M_contig69521.16669.1 vs. uniprot
Match: A0A518DPG0_9BACT (Plasmid pRiA4b ORF-3-like protein n=1 Tax=Lignipirellula cremea TaxID=2528010 RepID=A0A518DPG0_9BACT) HSP 1 Score: 60.5 bits (145), Expect = 1.160e-9 Identity = 27/36 (75.00%), Postives = 33/36 (91.67%), Query Frame = 0 Query: 1 MPTRKKIQPGEKVPFKLTVAEWKMVLEDLTCLDQNY 36 MPT+K+I+PGEKVP KLT+AE KMVLEDL CLDQ++ Sbjct: 1 MPTKKQIKPGEKVPLKLTLAERKMVLEDLMCLDQDF 36
BLAST of mRNA_M-pyrifera_M_contig69521.16669.1 vs. uniprot
Match: A0A518FWA9_9PLAN (Plasmid pRiA4b ORF-3-like protein n=1 Tax=Gimesia panareensis TaxID=2527978 RepID=A0A518FWA9_9PLAN) HSP 1 Score: 58.9 bits (141), Expect = 4.050e-9 Identity = 25/36 (69.44%), Postives = 31/36 (86.11%), Query Frame = 0 Query: 1 MPTRKKIQPGEKVPFKLTVAEWKMVLEDLTCLDQNY 36 MPT+K+IQPGEK+P KLT AE K++L DL CLDQ+Y Sbjct: 1 MPTQKQIQPGEKIPLKLTAAERKLILNDLLCLDQDY 36
BLAST of mRNA_M-pyrifera_M_contig69521.16669.1 vs. uniprot
Match: A0A517PVX0_9PLAN (Plasmid pRiA4b ORF-3-like protein n=3 Tax=Gimesia chilikensis TaxID=2605989 RepID=A0A517PVX0_9PLAN) HSP 1 Score: 56.2 bits (134), Expect = 3.620e-8 Identity = 24/36 (66.67%), Postives = 31/36 (86.11%), Query Frame = 0 Query: 1 MPTRKKIQPGEKVPFKLTVAEWKMVLEDLTCLDQNY 36 MPT+K+IQPGEKVP KLT AE K++L DL C++Q+Y Sbjct: 1 MPTKKQIQPGEKVPLKLTAAERKLILGDLPCVEQDY 36
BLAST of mRNA_M-pyrifera_M_contig69521.16669.1 vs. uniprot
Match: A6BYZ5_9PLAN (Probable lexA repressor n=1 Tax=Gimesia maris DSM 8797 TaxID=344747 RepID=A6BYZ5_9PLAN) HSP 1 Score: 55.8 bits (133), Expect = 4.960e-8 Identity = 24/36 (66.67%), Postives = 31/36 (86.11%), Query Frame = 0 Query: 1 MPTRKKIQPGEKVPFKLTVAEWKMVLEDLTCLDQNY 36 M T+K+IQPGEK+P KLT AE K++L+DL CLDQ+Y Sbjct: 1 MLTQKQIQPGEKIPLKLTAAERKLILDDLLCLDQDY 36 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig69521.16669.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig69521.16669.1 ID=prot_M-pyrifera_M_contig69521.16669.1|Name=mRNA_M-pyrifera_M_contig69521.16669.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=36bpback to top |