prot_M-pyrifera_M_contig69512.16663.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig69512.16663.1 vs. uniprot
Match: A0A1Y2GSU9_9FUNG (Secretory pathway protein Sec39-domain-containing protein n=1 Tax=Lobosporangium transversale TaxID=64571 RepID=A0A1Y2GSU9_9FUNG) HSP 1 Score: 72.0 bits (175), Expect = 6.820e-11 Identity = 37/99 (37.37%), Postives = 55/99 (55.56%), Query Frame = 0 Query: 128 RMTYKLSEFRCVVAEQFISQLVQKRQREQALAISATHDIAADVVYQHQWRLMDGFTVESILACLEPITNRQWVLEACYDTPVESLPQRRLLLQYGLRET 226 + T L V E+ + + + + ALAI+ T+++ DV+YQHQ R + F VE + L+ IT++QWVL C D+P E R LL+YGL T Sbjct: 645 KRTLSLYRILRVPPEELLYRKLDMKDYSSALAIATTYELNTDVIYQHQLRQLSLFNVEVVSTLLDKITDKQWVLAHCIDSPTEDQESIRTLLEYGLNLT 743 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig69512.16663.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig69512.16663.1 ID=prot_M-pyrifera_M_contig69512.16663.1|Name=mRNA_M-pyrifera_M_contig69512.16663.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=226bpback to top |