prot_M-pyrifera_M_contig6951.16661.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig6951.16661.1 vs. uniprot
Match: A0A6H5JRN1_9PHAE (CYTOSOL_AP domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5JRN1_9PHAE) HSP 1 Score: 84.7 bits (208), Expect = 2.220e-17 Identity = 48/77 (62.34%), Postives = 53/77 (68.83%), Query Frame = 0 Query: 4 ALSRRGGGVAXXXXXXGGASDVKPVPHLSVADMTYTPESKVEISASAVSDAGAWEGDTLVLLAFEQEDKEALAVIAG 80 ALS RGGGV G A+ PVP LSV DM YT ESK +S S VS A +WEGD LVLLAF+QEDKEA AV+AG Sbjct: 94 ALSTRGGGVVAMMSTSGAAT---PVPPLSVGDMCYTAESKASVSVSPVSKADSWEGDMLVLLAFQQEDKEAFAVLAG 167 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig6951.16661.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig6951.16661.1 ID=prot_M-pyrifera_M_contig6951.16661.1|Name=mRNA_M-pyrifera_M_contig6951.16661.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=80bpback to top |