prot_M-pyrifera_M_contig106797.1458.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig106797.1458.1 vs. uniprot
Match: A0A7S4E0C0_9EUKA (Hypothetical protein n=2 Tax=Lotharella globosa TaxID=91324 RepID=A0A7S4E0C0_9EUKA) HSP 1 Score: 50.8 bits (120), Expect = 7.690e-5 Identity = 39/121 (32.23%), Postives = 52/121 (42.98%), Query Frame = 0 Query: 5 DGVGTLEYTIAERGKEELADKW----EDARVSGSRRPQELVVRVKLPDGVNVQSLDVDSGRRFLLIQQEVEXXXXXXXXXXXXKSYSPLLHLRKLPYPIHHEKTKCKWKKATRTLVFTLQV 121 DG EYTI ERG + + E V G+RRPQ LVVR+K+P N + +D+D + L E P LPYP+ + K+KK LV TL + Sbjct: 304 DGKLKPEYTITERGSQAADQRLQFTSERFEVLGARRPQNLVVRIKIPQVKNTKDMDLDIDEKRLKFHAE------------------PYALDILLPYPVLPDNGSAKYKKICTMLVVTLPI 406 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig106797.1458.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig106797.1458.1 ID=prot_M-pyrifera_M_contig106797.1458.1|Name=mRNA_M-pyrifera_M_contig106797.1458.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=121bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|