prot_M-pyrifera_M_contig106700.1444.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig106700.1444.1 vs. uniprot
Match: A0A2E7KCS2_9PLAN (Uncharacterized protein n=5 Tax=Gimesia TaxID=1649453 RepID=A0A2E7KCS2_9PLAN) HSP 1 Score: 80.5 bits (197), Expect = 4.350e-14 Identity = 40/42 (95.24%), Postives = 42/42 (100.00%), Query Frame = 0 Query: 1 LLHLYAKAFARSGDGNKAVEVAQQIANLDLREKTLISIPGQI 42 LLHLYAKAFARSGDGNKAVEVAQQIANLDLRE+TLISIPG+I Sbjct: 228 LLHLYAKAFARSGDGNKAVEVAQQIANLDLREETLISIPGEI 269
BLAST of mRNA_M-pyrifera_M_contig106700.1444.1 vs. uniprot
Match: A0A517V650_9PLAN (Uncharacterized protein n=1 Tax=Gimesia algae TaxID=2527971 RepID=A0A517V650_9PLAN) HSP 1 Score: 73.9 bits (180), Expect = 7.750e-12 Identity = 37/41 (90.24%), Postives = 39/41 (95.12%), Query Frame = 0 Query: 2 LHLYAKAFARSGDGNKAVEVAQQIANLDLREKTLISIPGQI 42 LHLYAKAFARSGD NKAVEVAQQIANLDLRE+T+ISI GQI Sbjct: 211 LHLYAKAFARSGDSNKAVEVAQQIANLDLREETIISISGQI 251
BLAST of mRNA_M-pyrifera_M_contig106700.1444.1 vs. uniprot
Match: A0A355GDR1_9PLAN (Uncharacterized protein n=2 Tax=Planctomycetaceae TaxID=126 RepID=A0A355GDR1_9PLAN) HSP 1 Score: 71.6 bits (174), Expect = 4.780e-11 Identity = 35/43 (81.40%), Postives = 41/43 (95.35%), Query Frame = 0 Query: 1 LLHLYAKAFARSGDGNKAVEVAQQIANLDLREKTLISIPGQIA 43 LL+LY+KAFARSGD +KAVE+AQQI NLDLRE+T+ISIPGQIA Sbjct: 206 LLYLYSKAFARSGDSDKAVEMAQQIMNLDLREETMISIPGQIA 248 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig106700.1444.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig106700.1444.1 ID=prot_M-pyrifera_M_contig106700.1444.1|Name=mRNA_M-pyrifera_M_contig106700.1444.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=208bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|