prot_M-pyrifera_M_contig104489.968.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104489.968.1 vs. uniprot
Match: UPI0003F0B912 (low affinity immunoglobulin epsilon Fc receptor-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003F0B912) HSP 1 Score: 50.1 bits (118), Expect = 1.940e-5 Identity = 23/67 (34.33%), Postives = 33/67 (49.25%), Query Frame = 0 Query: 3 PDDCVLGEWGPWGNCSETCGGVGVMQRMREVLQPQMSTSGRSCVEVGGGSSLEEVLVEEQECAPESC 69 P+DC +G+WGPW +CS CG G M R R+++ + + GG S L + Q C C Sbjct: 35 PEDCTVGQWGPWSSCSAPCGTSGTMSRTRDIV---------TAAQCGGSCSFS--LTDSQSCNVGGC 90
BLAST of mRNA_M-pyrifera_M_contig104489.968.1 vs. uniprot
Match: A0A5C6PKM4_9TELE (Thrombospondin type-1 domain-containing protein 7A n=1 Tax=Takifugu flavidus TaxID=433684 RepID=A0A5C6PKM4_9TELE) HSP 1 Score: 48.5 bits (114), Expect = 8.140e-5 Identity = 22/43 (51.16%), Postives = 25/43 (58.14%), Query Frame = 0 Query: 3 PDDCVLGEWGPWGNCSETCGGVGVMQRMREVLQPQMSTSGRSC 45 PDDCVLG+WGPW +CS C R R VL+P GR C Sbjct: 1024 PDDCVLGDWGPWSHCSLPCTRANNRVRTRSVLRPP--AVGRKC 1064
BLAST of mRNA_M-pyrifera_M_contig104489.968.1 vs. uniprot
Match: A0A4Z2CD18_9TELE (Uncharacterized protein n=2 Tax=Takifugu bimaculatus TaxID=433685 RepID=A0A4Z2CD18_9TELE) HSP 1 Score: 48.5 bits (114), Expect = 8.170e-5 Identity = 22/43 (51.16%), Postives = 25/43 (58.14%), Query Frame = 0 Query: 3 PDDCVLGEWGPWGNCSETCGGVGVMQRMREVLQPQMSTSGRSC 45 PDDCVLG+WGPW +CS C R R VL+P GR C Sbjct: 1102 PDDCVLGDWGPWSHCSLPCTRANNRVRTRSVLRPP--AVGRKC 1142
BLAST of mRNA_M-pyrifera_M_contig104489.968.1 vs. uniprot
Match: A0A2D5ME30_9PLAN (Uncharacterized protein n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2D5ME30_9PLAN) HSP 1 Score: 48.5 bits (114), Expect = 8.190e-5 Identity = 20/37 (54.05%), Postives = 26/37 (70.27%), Query Frame = 0 Query: 5 DCVLGEWGPWGNCSETCGGVGVMQRMREVLQPQMSTS 41 DC++ EWG WGNCSE C G GV R+RE+ Q ++ S Sbjct: 1114 DCIVKEWGEWGNCSEPCNG-GVQWRVREIFQDRLQGS 1149
BLAST of mRNA_M-pyrifera_M_contig104489.968.1 vs. uniprot
Match: A0A2A9MJQ1_9APIC (LNR domain-containing protein n=1 Tax=Besnoitia besnoiti TaxID=94643 RepID=A0A2A9MJQ1_9APIC) HSP 1 Score: 48.5 bits (114), Expect = 8.250e-5 Identity = 21/46 (45.65%), Postives = 32/46 (69.57%), Query Frame = 0 Query: 3 PDDCVLGEWGPWGNCSETCGGVGVMQRMREVLQPQMSTSGRSCVEV 48 P++CV+ +WG WG+CS TCG G +R RE+L+ T+G+ C E+ Sbjct: 535 PENCVVSDWGEWGDCSTTCG-EGQSRRHREILK-HPDTNGQKCPEI 578 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104489.968.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 5
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig104489.968.1 ID=prot_M-pyrifera_M_contig104489.968.1|Name=mRNA_M-pyrifera_M_contig104489.968.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=69bpback to top |