prot_M-pyrifera_M_contig104399.943.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5K2D4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K2D4_9PHAE) HSP 1 Score: 86.3 bits (212), Expect = 2.450e-18 Identity = 38/55 (69.09%), Postives = 45/55 (81.82%), Query Frame = 0 Query: 2 HKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRL 56 H+TL+ WT +LLEDYPAYLA R+GGRTGNY +CV ALR LAP+ ATG+TNY L Sbjct: 570 HQTLKLWTPFLLEDYPAYLALRMGGRTGNYPMCVMALRKLAPMVGATGKTNYVTL 624
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5KQU3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KQU3_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 8.660e-13 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 0 Query: 2 HKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 HKT W Q+LL DYPAY+AFR RTGN+ L + AL +APIF +TG+ YQ LV Sbjct: 300 HKTFAVWKQFLLHDYPAYIAFRTALRTGNFRLRLDALHRIAPIFYSTGKDEYQFLV 355
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5KTG2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KTG2_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 8.800e-13 Identity = 32/56 (57.14%), Postives = 38/56 (67.86%), Query Frame = 0 Query: 2 HKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 HKT W Q+LL DYPAY+AFR RTGN+ L + LR +APIF TG+ YQ LV Sbjct: 40 HKTFAVWKQFLLHDYPAYIAFRTALRTGNFRLRLEGLRRIAPIFFITGKDKYQFLV 95
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5L6D9_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L6D9_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 8.830e-13 Identity = 32/56 (57.14%), Postives = 38/56 (67.86%), Query Frame = 0 Query: 2 HKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 HKT W Q+LL DYPAY+AFR RTGN+ L + LR +APIF TG+ YQ LV Sbjct: 1039 HKTFAVWKQFLLHDYPAYIAFRTALRTGNFRLRLEGLRRIAPIFFITGKDKYQFLV 1094
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5LD09_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LD09_9PHAE) HSP 1 Score: 65.9 bits (159), Expect = 4.050e-12 Identity = 30/56 (53.57%), Postives = 35/56 (62.50%), Query Frame = 0 Query: 2 HKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 HKT W Q+LL DYPAY+AF RTGN+ L + LR +APIF G YQ LV Sbjct: 40 HKTFAVWEQFLLHDYPAYIAFHTALRTGNFSLRLEGLRRIAPIFFIAGEDKYQFLV 95
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5L1K3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L1K3_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 4.190e-12 Identity = 31/56 (55.36%), Postives = 37/56 (66.07%), Query Frame = 0 Query: 2 HKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 HK W Q+LL DYPAY+AFR RTGN+ L + LR +APIF TG+ YQ LV Sbjct: 365 HKAFAVWKQFLLHDYPAYIAFRTALRTGNFRLRLEGLRRIAPIFFITGKDKYQFLV 420
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5K3J0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K3J0_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 5.690e-12 Identity = 31/57 (54.39%), Postives = 40/57 (70.18%), Query Frame = 0 Query: 1 KHKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 +HKT W Q+LL D+PAY+AFR RTG++ L + ALR +APIF TG+ YQ LV Sbjct: 321 EHKTFALWQQFLLHDFPAYMAFRTALRTGDFMLRLDALRRIAPIFYITGKDRYQFLV 377
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: D7FIA9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FIA9_ECTSI) HSP 1 Score: 66.6 bits (161), Expect = 1.990e-11 Identity = 31/55 (56.36%), Postives = 37/55 (67.27%), Query Frame = 0 Query: 3 KTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 KT W Q+LL DYPAY+AFR RTGN+ L + LR +APIF TG+ YQ LV Sbjct: 281 KTFAVWKQFLLHDYPAYIAFRTALRTGNFGLRLEGLRRIAPIFFITGKDKYQFLV 335
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5JK56_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JK56_9PHAE) HSP 1 Score: 65.9 bits (159), Expect = 3.730e-11 Identity = 31/56 (55.36%), Postives = 37/56 (66.07%), Query Frame = 0 Query: 2 HKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 HKT W Q+LL DYPAY+A R RTGN+ L + ALR +AP F TG+ YQ LV Sbjct: 102 HKTFAVWKQFLLHDYPAYIASRTALRTGNFRLRLDALRRIAPNFCITGKDKYQFLV 157
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5K245_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K245_9PHAE) HSP 1 Score: 63.5 bits (153), Expect = 5.050e-11 Identity = 30/56 (53.57%), Postives = 37/56 (66.07%), Query Frame = 0 Query: 2 HKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 HKT W Q+LL DYPAY+AFR RTGN+ L + LR + IF+ TG+ YQ LV Sbjct: 29 HKTFAVWKQFLLHDYPAYIAFRTALRTGNFRLRLVGLRRITSIFI-TGKDKYQFLV 83 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 18
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig104399.943.1 ID=prot_M-pyrifera_M_contig104399.943.1|Name=mRNA_M-pyrifera_M_contig104399.943.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=57bpback to top |