prot_M-pyrifera_M_contig104399.943.1 (polypeptide) Macrocystis pyrifera P11B4 male
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5K2D4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K2D4_9PHAE) HSP 1 Score: 86.3 bits (212), Expect = 2.450e-18 Identity = 38/55 (69.09%), Postives = 45/55 (81.82%), Query Frame = 0 Query: 2 HKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRL 56 H+TL+ WT +LLEDYPAYLA R+GGRTGNY +CV ALR LAP+ ATG+TNY L Sbjct: 570 HQTLKLWTPFLLEDYPAYLALRMGGRTGNYPMCVMALRKLAPMVGATGKTNYVTL 624
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5KQU3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KQU3_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 8.660e-13 Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 0 Query: 2 HKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 HKT W Q+LL DYPAY+AFR RTGN+ L + AL +APIF +TG+ YQ LV Sbjct: 300 HKTFAVWKQFLLHDYPAYIAFRTALRTGNFRLRLDALHRIAPIFYSTGKDEYQFLV 355
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5KTG2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KTG2_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 8.800e-13 Identity = 32/56 (57.14%), Postives = 38/56 (67.86%), Query Frame = 0 Query: 2 HKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 HKT W Q+LL DYPAY+AFR RTGN+ L + LR +APIF TG+ YQ LV Sbjct: 40 HKTFAVWKQFLLHDYPAYIAFRTALRTGNFRLRLEGLRRIAPIFFITGKDKYQFLV 95
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5L6D9_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L6D9_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 8.830e-13 Identity = 32/56 (57.14%), Postives = 38/56 (67.86%), Query Frame = 0 Query: 2 HKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 HKT W Q+LL DYPAY+AFR RTGN+ L + LR +APIF TG+ YQ LV Sbjct: 1039 HKTFAVWKQFLLHDYPAYIAFRTALRTGNFRLRLEGLRRIAPIFFITGKDKYQFLV 1094
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5LD09_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LD09_9PHAE) HSP 1 Score: 65.9 bits (159), Expect = 4.050e-12 Identity = 30/56 (53.57%), Postives = 35/56 (62.50%), Query Frame = 0 Query: 2 HKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 HKT W Q+LL DYPAY+AF RTGN+ L + LR +APIF G YQ LV Sbjct: 40 HKTFAVWEQFLLHDYPAYIAFHTALRTGNFSLRLEGLRRIAPIFFIAGEDKYQFLV 95
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5L1K3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L1K3_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 4.190e-12 Identity = 31/56 (55.36%), Postives = 37/56 (66.07%), Query Frame = 0 Query: 2 HKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 HK W Q+LL DYPAY+AFR RTGN+ L + LR +APIF TG+ YQ LV Sbjct: 365 HKAFAVWKQFLLHDYPAYIAFRTALRTGNFRLRLEGLRRIAPIFFITGKDKYQFLV 420
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5K3J0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K3J0_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 5.690e-12 Identity = 31/57 (54.39%), Postives = 40/57 (70.18%), Query Frame = 0 Query: 1 KHKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 +HKT W Q+LL D+PAY+AFR RTG++ L + ALR +APIF TG+ YQ LV Sbjct: 321 EHKTFALWQQFLLHDFPAYMAFRTALRTGDFMLRLDALRRIAPIFYITGKDRYQFLV 377
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: D7FIA9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FIA9_ECTSI) HSP 1 Score: 66.6 bits (161), Expect = 1.990e-11 Identity = 31/55 (56.36%), Postives = 37/55 (67.27%), Query Frame = 0 Query: 3 KTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 KT W Q+LL DYPAY+AFR RTGN+ L + LR +APIF TG+ YQ LV Sbjct: 281 KTFAVWKQFLLHDYPAYIAFRTALRTGNFGLRLEGLRRIAPIFFITGKDKYQFLV 335
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5JK56_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JK56_9PHAE) HSP 1 Score: 65.9 bits (159), Expect = 3.730e-11 Identity = 31/56 (55.36%), Postives = 37/56 (66.07%), Query Frame = 0 Query: 2 HKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 HKT W Q+LL DYPAY+A R RTGN+ L + ALR +AP F TG+ YQ LV Sbjct: 102 HKTFAVWKQFLLHDYPAYIASRTALRTGNFRLRLDALRRIAPNFCITGKDKYQFLV 157
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Match: A0A6H5K245_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K245_9PHAE) HSP 1 Score: 63.5 bits (153), Expect = 5.050e-11 Identity = 30/56 (53.57%), Postives = 37/56 (66.07%), Query Frame = 0 Query: 2 HKTLRFWTQYLLEDYPAYLAFRVGGRTGNYELCVAALRVLAPIFVATGRTNYQRLV 57 HKT W Q+LL DYPAY+AFR RTGN+ L + LR + IF+ TG+ YQ LV Sbjct: 29 HKTFAVWKQFLLHDYPAYIAFRTALRTGNFRLRLVGLRRITSIFI-TGKDKYQFLV 83 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104399.943.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 18 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig104399.943.1 ID=prot_M-pyrifera_M_contig104399.943.1|Name=mRNA_M-pyrifera_M_contig104399.943.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=57bpback to top |