prot_M-pyrifera_M_contig104321.917.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104321.917.1 vs. uniprot
Match: A0A7I8VMV0_9ANNE (DgyrCDS5529 n=1 Tax=Dimorphilus gyrociliatus TaxID=2664684 RepID=A0A7I8VMV0_9ANNE) HSP 1 Score: 52.4 bits (124), Expect = 1.310e-6 Identity = 19/38 (50.00%), Postives = 29/38 (76.32%), Query Frame = 0 Query: 33 NLLYPAEDRVSRRLVYKCNRCGRHEPAQSPCVHVNRIK 70 N+LYP ED+V++ L+Y C C EPA +PC++VN+I+ Sbjct: 62 NMLYPKEDKVTQTLLYACRNCEYQEPADNPCIYVNKIE 99
BLAST of mRNA_M-pyrifera_M_contig104321.917.1 vs. uniprot
Match: A0A0R3U9D8_MESCO (DNA-directed RNA polymerase subunit n=4 Tax=Cyclophyllidea TaxID=6201 RepID=A0A0R3U9D8_MESCO) HSP 1 Score: 51.2 bits (121), Expect = 1.820e-6 Identity = 19/38 (50.00%), Postives = 29/38 (76.32%), Query Frame = 0 Query: 33 NLLYPAEDRVSRRLVYKCNRCGRHEPAQSPCVHVNRIK 70 N+LYP ED+ ++RL+Y C C +PA +PCV+VNR++ Sbjct: 20 NMLYPKEDKRNKRLMYACRNCEYMQPADNPCVYVNRLE 57
BLAST of mRNA_M-pyrifera_M_contig104321.917.1 vs. uniprot
Match: A0A068XWH5_ECHMU (RNA polymerase II 15 kDa subunit n=2 Tax=Echinococcus TaxID=6209 RepID=A0A068XWH5_ECHMU) HSP 1 Score: 49.7 bits (117), Expect = 8.580e-6 Identity = 18/38 (47.37%), Postives = 28/38 (73.68%), Query Frame = 0 Query: 33 NLLYPAEDRVSRRLVYKCNRCGRHEPAQSPCVHVNRIK 70 N+LYP ED+ +RL+Y C C +PA +PC++VNR++ Sbjct: 20 NMLYPKEDKRHKRLMYACRNCEFMQPADNPCIYVNRLE 57
BLAST of mRNA_M-pyrifera_M_contig104321.917.1 vs. uniprot
Match: A0A4P9Y0I7_9FUNG (DNA-directed RNA polymerase subunit n=1 Tax=Piptocephalis cylindrospora TaxID=1907219 RepID=A0A4P9Y0I7_9FUNG) HSP 1 Score: 48.1 bits (113), Expect = 2.400e-5 Identity = 21/42 (50.00%), Postives = 26/42 (61.90%), Query Frame = 0 Query: 29 RYSQNLLYPAEDRVSRRLVYKCNRCGRHEPAQSPCVHVNRIK 70 R NLLYP ED V+R+L Y C C E A SPCV+ + +K Sbjct: 8 RNCNNLLYPEEDTVARKLFYGCRNCPYRETAASPCVYKHEVK 49 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104321.917.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig104321.917.1 ID=prot_M-pyrifera_M_contig104321.917.1|Name=mRNA_M-pyrifera_M_contig104321.917.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=70bpback to top |