prot_M-pyrifera_M_contig10394.834.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig10394.834.1 vs. uniprot
Match: D7FYS3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FYS3_ECTSI) HSP 1 Score: 100 bits (248), Expect = 2.130e-24 Identity = 49/60 (81.67%), Postives = 53/60 (88.33%), Query Frame = 0 Query: 18 QALDRTAGPDTLILLGVTRTDTEPDFFDALDKAGFEYNLVDQATHKGFGLFTVCRERRDE 77 QAL+RTAG TL+LLGVTRTDT P FFDALDKAGF YNLVDQA+HKGFGLFTV RE+ DE Sbjct: 160 QALERTAGQHTLVLLGVTRTDTGPAFFDALDKAGFVYNLVDQASHKGFGLFTVQREQPDE 219
BLAST of mRNA_M-pyrifera_M_contig10394.834.1 vs. uniprot
Match: W7U3Q4_9STRA (Nicotinamide N-methyltransferase, putative n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7U3Q4_9STRA) HSP 1 Score: 52.4 bits (124), Expect = 4.200e-6 Identity = 30/61 (49.18%), Postives = 36/61 (59.02%), Query Frame = 0 Query: 19 ALDRTAGPDTLILLGVTRTDTEPDFFDALDKAGFEYNLVDQATHK-------GFGLFTVCR 72 AL R +GP +LILLGVTRTDT P FF L + GF+Y L A + GF L +V R Sbjct: 198 ALCRLSGPHSLILLGVTRTDTNPRFFQLLQEEGFDYCLTPVADGESSCTVAGGFALLSVVR 258 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig10394.834.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig10394.834.1 ID=prot_M-pyrifera_M_contig10394.834.1|Name=mRNA_M-pyrifera_M_contig10394.834.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=79bpback to top |