prot_M-pyrifera_M_contig10197.424.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig10197.424.1 vs. uniprot
Match: D8LJU4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJU4_ECTSI) HSP 1 Score: 87.8 bits (216), Expect = 7.840e-15 Identity = 47/65 (72.31%), Postives = 57/65 (87.69%), Query Frame = 0 Query: 358 QLTEFDEKRDALELKEIMIVERTRERRKSLMKERAKGQAVIQYLTQLHREERIRSNFLRAKGNIL 422 ++ E+D +RDALELKEIMI ERTRERR+ LM+E+AKGQAV+QYLT+L REER RSN LRAKG +L Sbjct: 285 EVMEWDARRDALELKEIMIAERTRERRRGLMREQAKGQAVVQYLTKLEREERGRSNLLRAKGLML 349
BLAST of mRNA_M-pyrifera_M_contig10197.424.1 vs. uniprot
Match: A0A6H5KRP0_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KRP0_9PHAE) HSP 1 Score: 86.7 bits (213), Expect = 2.080e-14 Identity = 47/65 (72.31%), Postives = 56/65 (86.15%), Query Frame = 0 Query: 358 QLTEFDEKRDALELKEIMIVERTRERRKSLMKERAKGQAVIQYLTQLHREERIRSNFLRAKGNIL 422 +L E+D +RDALELKEIMI ERTRERR+ LM+E+AKGQAV+QYL +L REER RSN LRAKG +L Sbjct: 580 ELMEWDAQRDALELKEIMIAERTRERRRGLMREQAKGQAVVQYLAKLEREERGRSNLLRAKGLML 644 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig10197.424.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig10197.424.1 ID=prot_M-pyrifera_M_contig10197.424.1|Name=mRNA_M-pyrifera_M_contig10197.424.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=422bpback to top |