prot_M-pyrifera_M_contig101769.371.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig101769.371.1 vs. uniprot
Match: A0A399Z591_9CHLR (Uncharacterized protein n=2 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A399Z591_9CHLR) HSP 1 Score: 51.6 bits (122), Expect = 2.650e-5 Identity = 42/107 (39.25%), Postives = 61/107 (57.01%), Query Frame = 0 Query: 1 ASSGLGGAIGFEDDTTTEYSSLTVTNSRFLRNSAGSS----GGAIYSTGTILTVTDCFFAGNNGTDGGAVT--ASPYLNSAAAYIMDSNIFVGNYAASRGGAVWLAT 101 A++ GGAI E + T LTVTN+RF+ N+A GGAIYS G ++T+ +F GN+ + GGA+ ASP++ AA I + + S GGAV +A+ Sbjct: 117 ANNDKGGAIHVESSSAT----LTVTNARFMDNTASDPDNGYGGAIYSNG-VMTLEKIYFVGNSASRGGALASNASPFIAGHAAVIKTVDFKNNHVTTSNGGAVHVAS 218 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig101769.371.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig101769.371.1 ID=prot_M-pyrifera_M_contig101769.371.1|Name=mRNA_M-pyrifera_M_contig101769.371.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=110bpback to top |