mRNA_M-pyrifera_M_contig99674.22909.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99674.22909.1 vs. uniprot
Match: A0A1G2JCH4_9BACT (NodB homology domain-containing protein n=1 Tax=Candidatus Staskawiczbacteria bacterium RIFOXYC1_FULL_38_18 TaxID=1802229 RepID=A0A1G2JCH4_9BACT) HSP 1 Score: 52.0 bits (123), Expect = 3.370e-5 Identity = 20/39 (51.28%), Postives = 27/39 (69.23%), Query Frame = 1 Query: 25 WIPVPGDWDGDGIDTAASYDRQSGAWYIRNSNTPGGVDL 141 W+PV GDWDGDG T Y+ ++ +Y+RNSNT G D+ Sbjct: 45 WLPVAGDWDGDGTATIGLYNLKTSIFYLRNSNTTGVADI 83 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99674.22909.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig99674.22909.1 >prot_M-pyrifera_M_contig99674.22909.1 ID=prot_M-pyrifera_M_contig99674.22909.1|Name=mRNA_M-pyrifera_M_contig99674.22909.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=124bp VFGFGRRDWIPVPGDWDGDGIDTAASYDRQSGAWYIRNSNTPGGVDLFPFback to top mRNA from alignment at M-pyrifera_M_contig99674:7..378+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig99674.22909.1 ID=mRNA_M-pyrifera_M_contig99674.22909.1|Name=mRNA_M-pyrifera_M_contig99674.22909.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=372bp|location=Sequence derived from alignment at M-pyrifera_M_contig99674:7..378+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig99674:7..378+ >mRNA_M-pyrifera_M_contig99674.22909.1 ID=mRNA_M-pyrifera_M_contig99674.22909.1|Name=mRNA_M-pyrifera_M_contig99674.22909.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=744bp|location=Sequence derived from alignment at M-pyrifera_M_contig99674:7..378+ (Macrocystis pyrifera P11B4 male)back to top |