mRNA_M-pyrifera_M_contig95261.21976.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig95261.21976.1 vs. uniprot
Match: A0A1E7KQ57_9ACTN (Uncharacterized protein n=1 Tax=Streptomyces oceani TaxID=1075402 RepID=A0A1E7KQ57_9ACTN) HSP 1 Score: 53.9 bits (128), Expect = 1.930e-6 Identity = 26/73 (35.62%), Postives = 41/73 (56.16%), Query Frame = 1 Query: 28 LTAHVAPLGTSARP-AGDGWEVSVWYVEVL-VYGDEL---AVEQWRTATYTVEWEAGEWRMADLVSRDGPTPV 231 + + P+GT + G VSVWY + + G+E E W T T+T+EW+ G+W++AD ++GP PV Sbjct: 195 FVSRMIPVGTKTLDYSSSGATVSVWYSSLFGLTGEESKNPVTESWYTNTFTLEWDDGDWKVADFEQKEGPAPV 267
BLAST of mRNA_M-pyrifera_M_contig95261.21976.1 vs. uniprot
Match: A0A2A3H5H8_9ACTN (Uncharacterized protein n=1 Tax=Streptomyces sp. Tue6028 TaxID=2036037 RepID=A0A2A3H5H8_9ACTN) HSP 1 Score: 49.3 bits (116), Expect = 8.410e-5 Identity = 25/84 (29.76%), Postives = 45/84 (53.57%), Query Frame = 1 Query: 1 DVELSVPGGLT--AHVAPLGTSARPAGD-GWEVSVWYVEVLVYGDELAVEQ----WRTATYTVEWEAGEWRMADLVSRDGPTPV 231 D + + P G T + P+GT+ D G +VSVWY+ ++ + + + W+T T+ + W+ G+W++ +DGP PV Sbjct: 174 DAKGNPPAGSTFVSRTVPVGTTVHQYSDTGAKVSVWYMGLIGMSGQTSTDPVSSTWKTWTFELHWDNGDWKIVTDSQKDGPAPV 257 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig95261.21976.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig95261.21976.1 >prot_M-pyrifera_M_contig95261.21976.1 ID=prot_M-pyrifera_M_contig95261.21976.1|Name=mRNA_M-pyrifera_M_contig95261.21976.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=90bp DVELSVPGGLTAHVAPLGTSARPAGDGWEVSVWYVEVLVYGDELAVEQWRback to top mRNA from alignment at M-pyrifera_M_contig95261:298..567+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig95261.21976.1 ID=mRNA_M-pyrifera_M_contig95261.21976.1|Name=mRNA_M-pyrifera_M_contig95261.21976.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=270bp|location=Sequence derived from alignment at M-pyrifera_M_contig95261:298..567+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig95261:298..567+ >mRNA_M-pyrifera_M_contig95261.21976.1 ID=mRNA_M-pyrifera_M_contig95261.21976.1|Name=mRNA_M-pyrifera_M_contig95261.21976.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=540bp|location=Sequence derived from alignment at M-pyrifera_M_contig95261:298..567+ (Macrocystis pyrifera P11B4 male)back to top |