mRNA_M-pyrifera_M_contig94607.21827.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig94607.21827.1 vs. uniprot
Match: UPI0010BD6A76 (syntaxin-binding protein 5 n=1 Tax=Galendromus occidentalis TaxID=34638 RepID=UPI0010BD6A76) HSP 1 Score: 66.6 bits (161), Expect = 1.540e-11 Identity = 27/50 (54.00%), Postives = 38/50 (76.00%), Query Frame = 1 Query: 1 RPKMFNLRATLHHGVPGNPVAMAFDPVQRLLAVGTQQGLVKVFGKPGVEV 150 R ++FN+ T HG P NP A+A+DP+QRL+A+GT G +K+ G+PGVEV Sbjct: 46 RKELFNVAKTSRHGFPHNPSAVAYDPIQRLIAIGTHNGSIKILGRPGVEV 95
BLAST of mRNA_M-pyrifera_M_contig94607.21827.1 vs. uniprot
Match: A0A6J0B4M3_NEOLC (syntaxin-binding protein 5 isoform X4 n=2 Tax=Neodiprion lecontei TaxID=441921 RepID=A0A6J0B4M3_NEOLC) HSP 1 Score: 66.2 bits (160), Expect = 2.100e-11 Identity = 27/50 (54.00%), Postives = 38/50 (76.00%), Query Frame = 1 Query: 1 RPKMFNLRATLHHGVPGNPVAMAFDPVQRLLAVGTQQGLVKVFGKPGVEV 150 RP FN++ T HG P P A+AFDP+QRLLA+GT+ G +++ G+PGV+V Sbjct: 32 RPDHFNVKKTFRHGFPFQPTAIAFDPIQRLLAIGTKTGSLRILGRPGVDV 81
BLAST of mRNA_M-pyrifera_M_contig94607.21827.1 vs. uniprot
Match: A0A6J0B744_NEOLC (syntaxin-binding protein 5 isoform X1 n=29 Tax=Diprioninae TaxID=410274 RepID=A0A6J0B744_NEOLC) HSP 1 Score: 66.2 bits (160), Expect = 2.100e-11 Identity = 27/50 (54.00%), Postives = 38/50 (76.00%), Query Frame = 1 Query: 1 RPKMFNLRATLHHGVPGNPVAMAFDPVQRLLAVGTQQGLVKVFGKPGVEV 150 RP FN++ T HG P P A+AFDP+QRLLA+GT+ G +++ G+PGV+V Sbjct: 32 RPDHFNVKKTFRHGFPFQPTAIAFDPIQRLLAIGTKTGSLRILGRPGVDV 81
BLAST of mRNA_M-pyrifera_M_contig94607.21827.1 vs. uniprot
Match: UPI0017471739 (syntaxin-binding protein 5 isoform X5 n=2 Tax=Monomorium pharaonis TaxID=307658 RepID=UPI0017471739) HSP 1 Score: 66.2 bits (160), Expect = 2.100e-11 Identity = 27/50 (54.00%), Postives = 38/50 (76.00%), Query Frame = 1 Query: 1 RPKMFNLRATLHHGVPGNPVAMAFDPVQRLLAVGTQQGLVKVFGKPGVEV 150 RP+ F ++ T HG P P A+AFDPVQRLLA+GT+ G +++ G+PGV+V Sbjct: 32 RPEHFQVKKTFRHGFPHQPTALAFDPVQRLLAIGTKSGSLRILGRPGVDV 81
BLAST of mRNA_M-pyrifera_M_contig94607.21827.1 vs. uniprot
Match: UPI000625657C (syntaxin-binding protein 5 isoform X1 n=5 Tax=Athalia rosae TaxID=37344 RepID=UPI000625657C) HSP 1 Score: 66.2 bits (160), Expect = 2.100e-11 Identity = 27/50 (54.00%), Postives = 38/50 (76.00%), Query Frame = 1 Query: 1 RPKMFNLRATLHHGVPGNPVAMAFDPVQRLLAVGTQQGLVKVFGKPGVEV 150 RP FN++ T HG P P A+AFDP+QRLLA+GT+ G +++ G+PGV+V Sbjct: 32 RPDHFNVKKTFRHGFPFQPTAIAFDPIQRLLAIGTKTGSLRILGRPGVDV 81
BLAST of mRNA_M-pyrifera_M_contig94607.21827.1 vs. uniprot
Match: A0A8J5AMZ0_9DIPT (Uncharacterized protein n=1 Tax=Bradysia odoriphaga TaxID=1564500 RepID=A0A8J5AMZ0_9DIPT) HSP 1 Score: 62.4 bits (150), Expect = 2.410e-11 Identity = 24/47 (51.06%), Postives = 35/47 (74.47%), Query Frame = 1 Query: 7 KMFNLRATLHHGVPGNPVAMAFDPVQRLLAVGTQQGLVKVFGKPGVE 147 ++F R T+ HG P P A+A+DP +L+A+GTQ G +K+FG+PGVE Sbjct: 22 ELFAFRKTVQHGFPHKPTALAYDPKDKLMAIGTQSGAIKIFGRPGVE 68
BLAST of mRNA_M-pyrifera_M_contig94607.21827.1 vs. uniprot
Match: A0A7F5R274_AGRPL (syntaxin-binding protein 5 n=1 Tax=Agrilus planipennis TaxID=224129 RepID=A0A7F5R274_AGRPL) HSP 1 Score: 65.9 bits (159), Expect = 2.870e-11 Identity = 28/50 (56.00%), Postives = 38/50 (76.00%), Query Frame = 1 Query: 1 RPKMFNLRATLHHGVPGNPVAMAFDPVQRLLAVGTQQGLVKVFGKPGVEV 150 RP+ F ++ T HG P P AMAFDPVQRLLA+GT+ G +++ G+PGV+V Sbjct: 32 RPEHFQVKRTFRHGFPFQPTAMAFDPVQRLLAIGTKGGSLRILGQPGVDV 81
BLAST of mRNA_M-pyrifera_M_contig94607.21827.1 vs. uniprot
Match: A0A7R8D729_LEPSM (STXBP5 n=1 Tax=Lepeophtheirus salmonis TaxID=72036 RepID=A0A7R8D729_LEPSM) HSP 1 Score: 63.5 bits (153), Expect = 2.900e-11 Identity = 24/48 (50.00%), Postives = 38/48 (79.17%), Query Frame = 1 Query: 4 PKMFNLRATLHHGVPGNPVAMAFDPVQRLLAVGTQQGLVKVFGKPGVE 147 P+ F L+ TL HG P P++MA+D VQ+L+A+G + G+VK++GKPG++ Sbjct: 48 PEQFTLQPTLRHGFPFKPLSMAYDSVQKLMAIGNRSGVVKIYGKPGID 95
BLAST of mRNA_M-pyrifera_M_contig94607.21827.1 vs. uniprot
Match: UPI0006D8FA1A (syntaxin-binding protein 5-like n=1 Tax=Latimeria chalumnae TaxID=7897 RepID=UPI0006D8FA1A) HSP 1 Score: 62.0 bits (149), Expect = 4.120e-11 Identity = 27/45 (60.00%), Postives = 35/45 (77.78%), Query Frame = 1 Query: 13 FNLRATLHHGVPGNPVAMAFDPVQRLLAVGTQQGLVKVFGKPGVE 147 F L T+ HG P P AMAFDPVQ++LA+GTQ G +++FG+PGVE Sbjct: 44 FQLCKTVRHGFPYQPSAMAFDPVQKILAIGTQIGALRLFGRPGVE 88
BLAST of mRNA_M-pyrifera_M_contig94607.21827.1 vs. uniprot
Match: L7LZ29_RHIPC (V-SNARE coiled-coil homology domain-containing protein n=37 Tax=Ixodidae TaxID=6939 RepID=L7LZ29_RHIPC) HSP 1 Score: 65.1 bits (157), Expect = 5.360e-11 Identity = 26/49 (53.06%), Postives = 38/49 (77.55%), Query Frame = 1 Query: 1 RPKMFNLRATLHHGVPGNPVAMAFDPVQRLLAVGTQQGLVKVFGKPGVE 147 RP+ F + T+ HG P P A+AFDPVQR+LA+GT+ G +++FG+PGV+ Sbjct: 38 RPEHFKVSRTIRHGFPFQPTALAFDPVQRILAIGTKNGSLRLFGRPGVD 86 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig94607.21827.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig94607.21827.1 >prot_M-pyrifera_M_contig94607.21827.1 ID=prot_M-pyrifera_M_contig94607.21827.1|Name=mRNA_M-pyrifera_M_contig94607.21827.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=48bp MFNLRATLHHGVPGNPVAMAFDPVQRLLAVGTQQGLVKVFGKPGVEVLback to top mRNA from alignment at M-pyrifera_M_contig94607:22..174- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig94607.21827.1 ID=mRNA_M-pyrifera_M_contig94607.21827.1|Name=mRNA_M-pyrifera_M_contig94607.21827.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=153bp|location=Sequence derived from alignment at M-pyrifera_M_contig94607:22..174- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig94607:22..174- >mRNA_M-pyrifera_M_contig94607.21827.1 ID=mRNA_M-pyrifera_M_contig94607.21827.1|Name=mRNA_M-pyrifera_M_contig94607.21827.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=288bp|location=Sequence derived from alignment at M-pyrifera_M_contig94607:22..174- (Macrocystis pyrifera P11B4 male)back to top |