mRNA_M-pyrifera_M_contig94555.21821.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig94555.21821.1 vs. uniprot
Match: A0A1Y2CSM3_9FUNG (PseudoU_synth_2 domain-containing protein n=1 Tax=Rhizoclosmatium globosum TaxID=329046 RepID=A0A1Y2CSM3_9FUNG) HSP 1 Score: 60.5 bits (145), Expect = 2.170e-9 Identity = 30/49 (61.22%), Postives = 39/49 (79.59%), Query Frame = 1 Query: 1 LWFVHRLERLTSGLMVLATKHETVSQMATALSDRAVCKTYLARVLGRFP 147 L+ V+RL+RLTSG+++LA E SQ+AT LSDR V KTYL+RV G+FP Sbjct: 173 LYPVNRLDRLTSGILLLALTKEKASQLATELSDRNVSKTYLSRVRGKFP 221
BLAST of mRNA_M-pyrifera_M_contig94555.21821.1 vs. uniprot
Match: A0A485KXJ1_9STRA (Aste57867_13100 protein n=1 Tax=Aphanomyces stellatus TaxID=120398 RepID=A0A485KXJ1_9STRA) HSP 1 Score: 56.6 bits (135), Expect = 5.160e-8 Identity = 26/51 (50.98%), Postives = 35/51 (68.63%), Query Frame = 1 Query: 1 LWFVHRLERLTSGLMVLATKHETVSQMATALSDRAVCKTYLARVLGRFPGS 153 L VHRL+RLTSG+++LA ++T ++DR KTYLARVLG FP + Sbjct: 159 LHIVHRLDRLTSGVVILAKNSTKARDLSTTIADRTASKTYLARVLGMFPAA 209
BLAST of mRNA_M-pyrifera_M_contig94555.21821.1 vs. uniprot
Match: A0A024UVZ1_9STRA (PseudoU_synth_2 domain-containing protein n=2 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A024UVZ1_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 9.680e-8 Identity = 26/49 (53.06%), Postives = 34/49 (69.39%), Query Frame = 1 Query: 1 LWFVHRLERLTSGLMVLATKHETVSQMATALSDRAVCKTYLARVLGRFP 147 L VHRL+RLTSG+++LA T ++T ++DR KTYLARV G FP Sbjct: 163 LHIVHRLDRLTSGVVILAKNPSTARTLSTCIADRTASKTYLARVRGAFP 211
BLAST of mRNA_M-pyrifera_M_contig94555.21821.1 vs. uniprot
Match: A0A6G0XGG3_9STRA (PseudoU_synth_2 domain-containing protein n=1 Tax=Aphanomyces euteiches TaxID=100861 RepID=A0A6G0XGG3_9STRA) HSP 1 Score: 55.1 bits (131), Expect = 1.810e-7 Identity = 25/49 (51.02%), Postives = 34/49 (69.39%), Query Frame = 1 Query: 1 LWFVHRLERLTSGLMVLATKHETVSQMATALSDRAVCKTYLARVLGRFP 147 L VHRL+RLTSG+++LA T +++ ++DR KTYLARV G FP Sbjct: 158 LHIVHRLDRLTSGVVILAKNSNTARKLSACIADRTASKTYLARVRGTFP 206
BLAST of mRNA_M-pyrifera_M_contig94555.21821.1 vs. uniprot
Match: A0A024U1M2_9STRA (PseudoU_synth_2 domain-containing protein n=2 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A024U1M2_9STRA) HSP 1 Score: 55.1 bits (131), Expect = 1.810e-7 Identity = 27/46 (58.70%), Postives = 34/46 (73.91%), Query Frame = 1 Query: 10 VHRLERLTSGLMVLATKHETVSQMATALSDRAVCKTYLARVLGRFP 147 VHRL+RLTSGL+VLA E + ++T L DR+V K Y A+VLG FP Sbjct: 199 VHRLDRLTSGLLVLAKSAEVAADLSTQLIDRSVQKYYFAKVLGVFP 244
BLAST of mRNA_M-pyrifera_M_contig94555.21821.1 vs. uniprot
Match: A0A1Y2CR01_9FUNG (Pseudouridine synthase n=1 Tax=Rhizoclosmatium globosum TaxID=329046 RepID=A0A1Y2CR01_9FUNG) HSP 1 Score: 54.7 bits (130), Expect = 2.480e-7 Identity = 25/49 (51.02%), Postives = 38/49 (77.55%), Query Frame = 1 Query: 1 LWFVHRLERLTSGLMVLATKHETVSQMATALSDRAVCKTYLARVLGRFP 147 L+ V+R++RLTSG+++LA + +Q+AT L++R V KTYL RV G+FP Sbjct: 173 LFSVNRIDRLTSGILLLALTKDKATQLATELAERNVSKTYLCRVRGKFP 221
BLAST of mRNA_M-pyrifera_M_contig94555.21821.1 vs. uniprot
Match: A0A507EIL0_9FUNG (Pseudouridine synthase n=2 Tax=Chytriomyces confervae TaxID=246404 RepID=A0A507EIL0_9FUNG) HSP 1 Score: 54.3 bits (129), Expect = 3.390e-7 Identity = 24/49 (48.98%), Postives = 39/49 (79.59%), Query Frame = 1 Query: 1 LWFVHRLERLTSGLMVLATKHETVSQMATALSDRAVCKTYLARVLGRFP 147 L+ V+R++RLTSG++++A + + +++A L+DR V KTYL+RV GRFP Sbjct: 170 LFSVNRIDRLTSGILLVALRKDKAAELAAQLADRTVEKTYLSRVKGRFP 218
BLAST of mRNA_M-pyrifera_M_contig94555.21821.1 vs. uniprot
Match: A0A396ZMT5_9STRA (PseudoU_synth_2 domain-containing protein n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A396ZMT5_9STRA) HSP 1 Score: 53.9 bits (128), Expect = 3.760e-7 Identity = 25/46 (54.35%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 10 VHRLERLTSGLMVLATKHETVSQMATALSDRAVCKTYLARVLGRFP 147 VHRL+RLTSGL+VLA + ++++ L +R+V K Y A+VLGRFP Sbjct: 175 VHRLDRLTSGLLVLAKSADKAAELSAQLVERSVQKFYFAKVLGRFP 220
BLAST of mRNA_M-pyrifera_M_contig94555.21821.1 vs. uniprot
Match: W4GIG4_9STRA (PseudoU_synth_2 domain-containing protein n=2 Tax=Aphanomyces astaci TaxID=112090 RepID=W4GIG4_9STRA) HSP 1 Score: 53.9 bits (128), Expect = 4.490e-7 Identity = 25/46 (54.35%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 10 VHRLERLTSGLMVLATKHETVSQMATALSDRAVCKTYLARVLGRFP 147 VHRL+RLTSGL+VLA + ++++ L +R+V K Y A+VLGRFP Sbjct: 199 VHRLDRLTSGLLVLAKSADKAAELSAQLVERSVQKFYFAKVLGRFP 244
BLAST of mRNA_M-pyrifera_M_contig94555.21821.1 vs. uniprot
Match: A0A1V9YKI9_9STRA (PseudoU_synth_2 domain-containing protein n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9YKI9_9STRA) HSP 1 Score: 53.9 bits (128), Expect = 4.630e-7 Identity = 26/46 (56.52%), Postives = 33/46 (71.74%), Query Frame = 1 Query: 10 VHRLERLTSGLMVLATKHETVSQMATALSDRAVCKTYLARVLGRFP 147 VHRL+RLTSGL+VLA E M+ L DR++ K Y+A+V GRFP Sbjct: 197 VHRLDRLTSGLLVLAKTPEKAQTMSAQLVDRSMLKYYVAKVAGRFP 242 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig94555.21821.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig94555.21821.1 >prot_M-pyrifera_M_contig94555.21821.1 ID=prot_M-pyrifera_M_contig94555.21821.1|Name=mRNA_M-pyrifera_M_contig94555.21821.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=51bp LWFVHRLERLTSGLMVLATKHETVSQMATALSDRAVCKTYLARVLGRFPGback to top mRNA from alignment at M-pyrifera_M_contig94555:14..166+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig94555.21821.1 ID=mRNA_M-pyrifera_M_contig94555.21821.1|Name=mRNA_M-pyrifera_M_contig94555.21821.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=153bp|location=Sequence derived from alignment at M-pyrifera_M_contig94555:14..166+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig94555:14..166+ >mRNA_M-pyrifera_M_contig94555.21821.1 ID=mRNA_M-pyrifera_M_contig94555.21821.1|Name=mRNA_M-pyrifera_M_contig94555.21821.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=306bp|location=Sequence derived from alignment at M-pyrifera_M_contig94555:14..166+ (Macrocystis pyrifera P11B4 male)back to top |